Details for Arabidopsis Locus AT3G04850

Position : Chr3 ( 5`- 1331946 .. 1335993 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G04850

Protein [Map View]
MDTPDKNRISAVSFCNFEDSPVFQYINDLSPIEPVKPGRPENILHSLVFTSPSSSSSLFCSPQLNSYRDSRFFIKRHRSL
DLSSPVVLIGETLKNSPDALWEEKLKCRPEKLENVSEPKPFKEQISLAIELANSLKHGRDGCDIQMVSCDEVPMDADDEI
GSGGGSRELSDELCRQSFDPLDFDADSDGVLHTDEMEAESGFGKEVIMFDVADIQNYEQQIPRTTDPRFYSLASEPQQFS
IYCNNSNYVEEREGSCSVQVAAGAPDINLSCSSKVAAIDSTAEAEDKEDKDLQPSGKQRSVRRRCLTFDMGGSHKRIPLR
DSTNDLPLDSTSINKAPSPQNCLDTSKQDTDEILPIPRTIGLHLNGFVNPSVSSGRKKKKIKDGQAFPSTTFHYNIEDEF
STPVSTKRDLVVFSDVKIMEPPERSVEGECFDQLMAMENRQLSQGLDELGSCKRCKCRKSQCLKLYCECFSAGLFCGEPC
SCQNCFNKPIHEDLVMKSREVIKARNPLAFAPKVVSTSDTVIDLWVENSKTPASARHKRGCNCRKSGCSKKYCECFMMGV
GCSSNCRCMGCKNTFGHTNEQCAGDSDVVTINDEAKHYGDHGDASRQNEEILTSERNRLLLPGSVAFRSLTSLSNLSEL*

DNA
ATGGATACACCAGATAAGAACCGCATCTCCGCCGTTTCCTTCTGCAACTTCGAGGATTCTCCAGTTTTTCAATATATTAA
TGATCTCTCTCCAATAGAGCCAGTGAAGCCAGGACGCCCAGAGAATATCTTGCACTCACTGGTTTTTACATCTCCATCAT
CATCATCATCTCTATTTTGTTCCCCGCAGTTAAACTCTTACCGAGATTCCAGATTTTTCATCAAAAGGCATCGTTCTCTA
GATCTATCGAGTCCAGTAGTCCTCATCGGTGAGACTCTAAAAAACTCACCAGATGCTTTATGGGAGGAGAAGCTAAAGTG
TAGGCCTGAGAAGTTGGAAAATGTTTCTGAACCCAAGCCATTTAAGGAGCAGATAAGCTTAGCAATTGAGTTGGCGAATT
CATTGAAACACGGAAGAGATGGATGTGATATTCAGATGGTTTCTTGTGATGAAGTACCTATGGATGCTGATGATGAAATA
GGAAGCGGTGGTGGATCCAGAGAGCTGTCTGATGAGTTATGTAGACAGTCTTTTGATCCACTTGACTTTGATGCTGATTC
AGATGGAGTACTTCACACTGATGAAATGGAAGCTGAGAGTGGGTTTGGTAAAGAAGTAATAATGTTTGATGTTGCTGATA
TCCAGAACTATGAGCAACAGATTCCAAGGACCACAGATCCTAGATTTTATTCTCTTGCTTCTGAGCCTCAACAGTTTTCT
ATCTACTGTAATAACTCAAATTATGTCGAAGAGCGGGAAGGTTCGTGCAGTGTACAAGTTGCAGCTGGAGCTCCAGACAT
TAATCTCAGTTGTTCCTCCAAGGTAGCAGCTATTGATTCAACTGCCGAAGCTGAAGACAAGGAAGATAAAGACCTTCAGC
CCAGTGGCAAGCAACGAAGTGTACGCAGGCGCTGCTTAACTTTTGACATGGGAGGGTCTCACAAAAGGATACCTTTGCGT
GATTCTACAAATGATCTTCCTCTTGATTCTACCTCTATCAATAAAGCTCCCAGTCCACAAAATTGTTTAGACACCAGTAA
ACAAGACACTGATGAGATTCTACCCATTCCACGAACGATTGGCCTGCACTTGAATGGTTTCGTGAACCCCTCAGTCTCAA
GTGGCCGAAAAAAAAAAAAAATCAAAGATGGTCAGGCTTTTCCTTCTACAACATTTCATTATAATATTGAAGATGAATTC
TCAACTCCTGTCTCCACAAAAAGAGATTTGGTGGTATTCAGTGATGTCAAAATCATGGAGCCTCCTGAGAGATCAGTGGA
AGGAGAATGTTTTGACCAACTCATGGCAATGGAAAATAGGCAATTGTCTCAAGGACTTGACGAACTTGGCAGCTGTAAGC
GCTGTAAATGTAGGAAATCACAATGCTTGAAGCTGTATTGTGAATGTTTTTCCGCTGGTCTATTCTGTGGTGAACCTTGT
TCATGTCAAAATTGTTTCAATAAGCCCATTCATGAAGACCTAGTTATGAAAAGTCGTGAAGTGATTAAAGCCCGCAACCC
ATTAGCTTTTGCTCCAAAAGTGGTCTCAACTTCTGATACTGTTATAGATTTATGGGTCGAGAACAGCAAGACTCCTGCTT
CAGCAAGACACAAAAGAGGATGCAACTGCAGGAAATCAGGCTGCTCAAAGAAATATTGTGAATGCTTTATGATGGGCGTT
GGATGCTCCTCTAACTGCAGATGCATGGGATGCAAGAATACTTTTGGTCACACAAATGAGCAATGTGCGGGAGATTCTGA
TGTGGTAACAATCAATGATGAAGCTAAACACTATGGTGATCATGGCGATGCTTCAAGGCAAAACGAAGAAATCTTAACCA
GTGAGAGAAACCGCTTGTTGCTCCCTGGTTCTGTAGCATTCCGTTCCTTAACATCACTGTCAAACCTGTCTGAACTTTGA