Details for Arabidopsis Locus AT3G04840

Position : Chr3 ( 5`- 1329665 .. 1331617 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G04840

Protein [Map View]
MAVGKNKRISKGRKGGKKKAVDPFSKKDWYDVKAPSIFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNA
YRKIRLRAEDVQGRNVLCQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTLRLFCIAFTKRRANQVKRTCYAQSSQ
IRQIRRKMRDIMVREASSCDLKDLVAKFIPEAIGREIEKATQGIYPLQNVFIRKVKILKAPKFDLGKLMDVHGDYSAEDV
GVKVDRPADEMAVEEPTEIIGA*

DNA
ATGGCCGTCGGGAAAAACAAGAGAATCTCTAAGGGTAGGAAGGGAGGAAAGAAGAAGGCTGTTGATCCTTTCTCCAAGAA
AGATTGGTATGATGTTAAGGCTCCTTCAATCTTCACTCACAGGAATGTTGGAAAGACACTTGTTTCCAGAACTCAGGGTA
CCAAAATTGCCTCAGAAGGCTTGAAACACAGAGTTTTTGAGGTTTCTCTTGCTGATCTTCAAGGTGATGAGGATAACGCT
TACAGGAAGATCCGTCTCAGAGCTGAAGATGTCCAGGGCAGGAACGTTCTGTGCCAATTCTGGGGCATGGACTTCACCAC
CGATAAACTTAGGTCATTGGTTAAGAAGTGGCAGACTTTGATTGAGGCTCATGTTGATGTTAAAACCACCGACAGTTACA
CTCTCAGGCTATTCTGTATCGCCTTCACCAAGAGACGTGCTAACCAGGTCAAGAGGACTTGCTACGCTCAATCCAGCCAA
ATCCGTCAGATCCGCAGGAAGATGAGGGACATCATGGTTAGGGAAGCTTCCTCATGTGACCTTAAGGATCTTGTTGCTAA
GTTCATTCCTGAAGCTATTGGCAGGGAGATTGAGAAGGCAACTCAGGGCATCTACCCTCTTCAGAATGTTTTCATCCGTA
AAGTCAAGATCCTCAAGGCCCCTAAATTCGACCTTGGCAAGCTCATGGATGTTCACGGAGATTACTCAGCAGAAGATGTT
GGTGTTAAGGTAGACAGGCCGGCTGATGAGATGGCTGTTGAGGAACCTACTGAAATCATCGGAGCTTAA