Details for Arabidopsis Locus AT3G04830

Position : Chr3 ( 5`- 1326227 .. 1329364 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G04830

Protein [Map View]
MVTKTEEIQLNQLENQVENGGGGVWEYLCLVRKLKVRRSEIVLKHGLSILNDSGKRSALGPDEWTLYEQVAIAAMDCQSL
GVAQNCIKVLKKKFPESKRVGKLEALLLEAKGMWEEAEKAYTSLLEDNPLDQVIHKRKVAMAKAQGKSSLAIEHLNKYLE
VFMADHDAWRELAEIYVSLQMYKQAAFCYEELILTQPTLPLYHLAYADVLYTIGGLENLIAARKYYAATIDLTGGKSTRA
LLGICLCGSAIAQISKGRNKEDKDMAAPELQSLAATALEREYKQKAPAKLNLLTSALRNLKIA*

DNA
ATGGTGACGAAAACGGAGGAGATACAGTTAAACCAACTCGAGAATCAAGTTGAGAATGGAGGAGGAGGTGTTTGGGAGTA
TCTGTGCCTCGTTCGTAAGCTCAAGGTTCGCCGATCAGAGATTGTGCTCAAGCATGGTCTCTCGATCTTGAACGATTCGG
GAAAGCGATCCGCTCTTGGTCCAGATGAATGGACCCTGTATGAGCAGGTAGCAATTGCAGCTATGGACTGTCAATCTCTC
GGTGTTGCACAGAATTGCATCAAGGTTCTAAAGAAGAAATTTCCGGAGAGCAAACGTGTTGGCAAGCTGGAGGCTCTGCT
GCTAGAAGCAAAGGGAATGTGGGAAGAGGCTGAAAAAGCATATACAAGCCTTTTGGAGGATAATCCACTTGATCAAGTAA
TTCACAAAAGAAAGGTGGCTATGGCCAAGGCACAAGGCAAATCTTCCTTAGCCATTGAACATCTGAACAAGTATCTTGAA
GTATTCATGGCTGATCATGATGCCTGGAGAGAACTTGCAGAAATTTATGTTTCCTTGCAAATGTACAAGCAAGCAGCTTT
CTGCTACGAGGAGCTCATACTAACTCAGCCTACTCTTCCATTGTACCACTTAGCATATGCCGATGTTCTCTACACAATAG
GTGGACTAGAAAACCTCATCGCAGCAAGAAAGTACTATGCAGCAACTATAGACTTGACAGGTGGTAAAAGCACAAGAGCA
CTTCTCGGAATATGCTTGTGTGGATCAGCAATCGCACAGATCTCAAAAGGCAGGAACAAAGAGGACAAGGACATGGCTGC
ACCAGAGCTTCAGTCTTTGGCTGCAACTGCATTGGAGCGAGAGTACAAGCAAAAAGCTCCCGCTAAGCTCAACCTCCTCA
CTTCTGCCTTGAGAAACTTGAAAATCGCTTAG