Details for Arabidopsis Locus AT3G04820

Position : Chr3 ( 5`- 1321228 .. 1325953 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G04820

Protein [Map View]
MKLSRTVLSCLPSLLKPYSSLSWTTKIATIATNFEGMKTVDEADVGISCFISQLPGFRGILKQRYADFIVNEVDMDGNVV
HLTSLDLPPEMAVKEEDKAKSCDNVPQNYTSAVESFKSISSVTDAERLEILINQVTSGTDGEVLPVVLDPSSDKSKRTAI
HNFVKENFKFLVTDTVDGPDSTSKCIRVRVNSGANNNRGNRSKKRKERGDKPFDSRGSEHWPEHVGKFLRFHLYKENKDT
QEALGLIGKMLGVQPKSFGFSGTKDKRSVSTQRVTVFKQQASKLAALNKRLFGIKVGDFCNVKEGLLLGQLMGNRFTITL
RGVVADSEETIKQSAESLGKDGFINYFGLQRFGSGSVPTHHVGAALLKGEWKDAVDMILDPRETERHVVNDAREYYKETG
DIDGTLRQLPRYLVAERAILQCLKKCPGNYLQALKGIPRTLRMMYVHSYQSYLWNNAASLRVKNYGTSQVVLGDLVSTKV
DAAKRMVDSLTSEHNESSEEALDCDQVDDTAVVDLPAERSDLVKVVSIEDLEAGTYSTSDIVLPLPGSRVIYPSNDIAEI
YHDLAKKDGISLTESIHGVKEFSITSMTGGYRRVFQKPIDFEWELLTYTDSNKPLAETDLDRIPMNKPVEKVGSTEEIED
ESMKSDTNPHDSGETNLKDQTDSNEAEKDTGNPDSEQTQMALKMALTLPSSCYATMAIRELLKTSTSVAYHKTLN*

DNA
ATGAAATTAAGTAGAACTGTCTTGTCTTGTTTGCCGTCTCTGCTAAAACCCTACTCGAGCTTGAGCTGGACAACGAAAAT
AGCGACGATAGCTACAAACTTTGAAGGTATGAAAACAGTAGATGAAGCTGACGTGGGCATCTCCTGTTTTATCTCCCAGC
TCCCTGGCTTCCGTGGAATCCTCAAACAAAGATACGCAGACTTTATTGTTAATGAAGTAGATATGGATGGTAATGTGGTT
CATTTGACATCCTTGGACTTGCCTCCTGAGATGGCTGTGAAGGAGGAGGATAAAGCGAAAAGTTGTGATAATGTACCCCA
AAATTATACTTCTGCAGTTGAGTCTTTCAAATCTATTTCCAGTGTTACTGATGCAGAGCGTTTGGAAATATTGATCAATC
AAGTCACCTCAGGAACTGATGGTGAAGTCTTACCAGTTGTTCTTGATCCAAGTTCTGACAAATCCAAGAGAACGGCTATC
CACAACTTTGTTAAAGAGAATTTCAAGTTCCTAGTGACTGACACTGTCGACGGTCCTGATTCTACTTCAAAATGCATCCG
TGTGCGAGTGAATTCAGGAGCCAATAACAACAGAGGTAATAGATCAAAAAAACGAAAGGAAAGAGGCGATAAGCCTTTTG
ATAGCAGAGGTTCAGAGCATTGGCCAGAGCATGTTGGCAAGTTTCTCAGGTTCCATCTTTACAAGGAGAACAAAGATACA
CAAGAGGCCTTGGGATTGATTGGAAAGATGCTAGGCGTTCAGCCAAAGTCATTCGGATTCTCTGGAACAAAAGATAAGCG
GTCTGTTTCTACTCAGCGTGTAACTGTGTTCAAACAGCAAGCTAGCAAATTGGCTGCGCTTAACAAGAGATTGTTTGGGA
TCAAAGTTGGTGACTTCTGCAATGTCAAAGAGGGCCTTCTCCTTGGGCAGCTCATGGGAAACAGATTTACTATCACATTA
AGAGGAGTGGTTGCGGATTCTGAAGAAACTATAAAACAATCTGCAGAATCCTTGGGGAAAGATGGCTTCATCAACTACTT
TGGCTTGCAGCGTTTTGGAAGTGGTTCAGTACCAACCCACCATGTAGGAGCTGCACTATTGAAAGGAGAGTGGAAAGATG
CTGTAGACATGATTCTTGATCCAAGAGAAACTGAAAGGCATGTAGTAAATGATGCCCGGGAATATTACAAAGAAACTGGT
GACATTGACGGGACTCTAAGGCAACTACCGCGATACCTCGTTGCTGAAAGAGCCATACTGCAGTGTCTGAAGAAATGCCC
TGGTAACTACCTGCAGGCTCTTAAAGGCATTCCCAGAACTTTGAGAATGATGTATGTACATAGTTATCAAAGCTACTTAT
GGAACAATGCAGCAAGTCTGCGCGTCAAAAATTATGGAACCAGCCAAGTTGTGTTGGGGGACTTGGTAAGTACAAAGGTA
GATGCTGCAAAAAGAATGGTCGACAGTCTTACCTCTGAGCACAACGAAAGCAGCGAAGAGGCATTGGATTGTGACCAGGT
AGATGATACTGCTGTTGTAGATCTTCCAGCTGAAAGGAGTGACCTTGTTAAGGTTGTAAGTATAGAGGATTTGGAAGCTG
GAACTTACTCGACCAGTGACATCGTCCTCCCTCTACCTGGTTCAAGAGTCATCTACCCGTCTAATGACATTGCAGAAATT
TATCATGATTTGGCAAAGAAGGACGGTATCAGCCTAACTGAGAGCATTCACGGTGTAAAGGAATTCTCAATAACTAGCAT
GACTGGTGGTTATAGACGTGTTTTCCAGAAACCAATAGACTTTGAATGGGAATTACTGACTTACACTGACAGCAATAAAC
CATTGGCAGAGACGGATCTGGACAGGATACCCATGAACAAGCCGGTGGAGAAAGTTGGATCTACTGAGGAAATTGAAGAT
GAATCAATGAAATCTGATACTAACCCACATGATTCTGGTGAAACCAATTTGAAAGACCAGACAGATAGCAATGAGGCTGA
AAAAGACACTGGAAATCCAGATTCTGAGCAGACACAGATGGCGCTTAAAATGGCACTCACTCTTCCATCTTCTTGTTATG
CCACAATGGCAATCAGAGAACTATTAAAGACGTCAACTTCTGTTGCATATCACAAGACACTTAACTAG