Details for Arabidopsis Locus AT3G04780

Position : Chr3 ( 5`- 1311247 .. 1313090 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G04780

Protein [Map View]
MSAESASQIPKGQVDLLDFIDWSGVECLNQSSSHSLPNALKQGYREDEGLNLESDADEQLLIYIPFNQVIKLHSFAIKGP
EEEGPKTVKFFSNKEHMCFSNVNDFPPSDTAELTEENLKGKPVVLKYVKFQNVRSLTIFIEANQSGSEVTKVQKIALYGS
TVETTDMKGLKKIEDH*

DNA
ATGTCCGCCGAATCAGCTAGCCAAATTCCTAAGGGACAGGTTGATCTACTAGATTTTATTGACTGGTCTGGTGTTGAATG
TCTTAACCAAAGCTCAAGTCACTCTTTGCCCAATGCTCTCAAGCAGGGATATAGAGAAGATGAAGGTTTAAACTTAGAGA
GTGATGCTGATGAACAACTTCTCATCTATATTCCTTTTAACCAAGTTATCAAACTACATTCCTTTGCTATCAAAGGCCCT
GAAGAGGAAGGTCCTAAAACTGTAAAGTTTTTCTCAAACAAAGAGCACATGTGCTTCAGCAATGTCAATGATTTTCCTCC
AAGCGACACCGCTGAACTAACTGAAGAAAACCTTAAGGGAAAACCGGTGGTCCTAAAGTACGTAAAGTTTCAGAATGTTC
GTAGCTTGACGATCTTCATCGAAGCCAACCAATCAGGTTCTGAGGTCACCAAGGTTCAGAAGATTGCTCTCTATGGCTCA
ACGGTGGAGACGACTGATATGAAGGGATTGAAAAAGATTGAAGATCACTGA