Details for Arabidopsis Locus AT3G04750

Position : Chr3 ( 5`- 1301391 .. 1303376 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G04750

Protein [Map View]
MCFVLLLRRGFRLFGTECGSKTTKWDPVQSLQLNHQSLVLLENCNSRNQFKQVLAQIMRFNLICDTFPMSRLIFFSAITY
PENLDLAKLLFLNFTPNPNVFVYNTMISAVSSSKNECFGLYSSMIRHRVSPDRQTFLYLMKASSFLSEVKQIHCHIIVSG
CLSLGNYLWNSLVKFYMELGNFGVAEKVFARMPHPDVSSFNVMIVGYAKQGFSLEALKLYFKMVSDGIEPDEYTVLSLLV
CCGHLSDIRLGKGVHGWIERRGPVYSSNLILSNALLDMYFKCKESGLAKRAFDAMKKKDMRSWNTMVVGFVRLGDMEAAQ
AVFDQMPKRDLVSWNSLLFGYSKKGCDQRTVRELFYEMTIVEKVKPDRVTMVSLISGAANNGELSHGRWVHGLVIRLQLK
GDAFLSSALIDMYCKCGIIERAFMVFKTATEKDVALWTSMITGLAFHGNGQQALQLFGRMQEEGVTPNNVTLLAVLTACS
HSGLVEEGLHVFNHMKDKFGFDPETEHYGSLVDLLCRAGRVEEAKDIVQKKMPMRPSQSMWGSILSACRGGEDIETAELA
LTELLKLEPEKEGGYVLLSNIYATVGRWGYSDKTREAMENRGVKKTAGYSSVVGVEGLHRFVAAEKQNHPRWTEIKRILQ
HLYNEMKPKLDCLDLLEIEIK*

DNA
ATGTGCTTTGTGTTGTTGTTGCGGCGAGGATTTCGATTATTTGGCACAGAATGTGGGAGCAAGACAACCAAATGGGATCC
TGTTCAATCACTTCAGCTGAATCATCAATCTCTTGTCTTGCTCGAGAATTGCAATTCCAGGAATCAATTCAAGCAGGTTT
TGGCACAGATCATGCGTTTCAATCTCATCTGCGATACGTTTCCCATGAGCCGTCTTATCTTCTTCTCGGCGATCACATAC
CCAGAGAATCTCGACTTGGCGAAGCTTCTATTTCTTAATTTCACTCCCAACCCGAATGTTTTTGTTTACAACACAATGAT
ATCTGCTGTTTCGAGCTCGAAAAATGAATGCTTTGGTCTGTATAGTTCTATGATTAGGCACCGTGTCTCTCCTGACAGGC
AAACGTTTCTCTATCTCATGAAAGCTTCGAGTTTTCTGTCGGAAGTGAAGCAGATCCATTGCCATATCATTGTTTCTGGG
TGTTTGTCTCTTGGGAATTACCTGTGGAATTCTCTGGTTAAGTTTTACATGGAGTTGGGAAATTTTGGTGTTGCAGAGAA
GGTGTTTGCTAGAATGCCTCATCCAGATGTCAGCTCTTTTAACGTTATGATTGTTGGTTATGCTAAGCAGGGTTTTAGTT
TAGAGGCACTTAAACTGTATTTTAAGATGGTTAGTGATGGTATTGAACCTGATGAGTACACTGTGCTGAGTCTTCTTGTT
TGTTGTGGTCATTTATCAGATATTAGACTTGGGAAGGGAGTTCATGGTTGGATTGAGAGGAGAGGACCTGTTTATTCATC
TAATTTGATTCTGAGCAATGCTCTTTTGGACATGTATTTCAAATGCAAAGAATCTGGTCTTGCTAAAAGAGCTTTTGATG
CGATGAAGAAGAAAGACATGCGCTCTTGGAACACCATGGTTGTTGGGTTTGTTAGGCTTGGGGACATGGAAGCTGCTCAG
GCTGTTTTTGATCAGATGCCCAAAAGGGATCTTGTTTCTTGGAACTCTCTTCTTTTTGGTTATTCGAAGAAGGGATGTGA
CCAAAGAACCGTCAGAGAATTGTTCTATGAAATGACGATCGTGGAGAAGGTCAAGCCAGACCGCGTCACTATGGTTAGTT
TGATAAGTGGTGCAGCAAACAACGGAGAACTGAGCCATGGAAGATGGGTGCACGGATTAGTGATCCGTCTGCAACTGAAA
GGTGATGCCTTTCTGAGTTCGGCTCTGATAGATATGTACTGCAAATGTGGTATCATTGAGCGGGCTTTTATGGTTTTCAA
GACAGCTACCGAGAAAGATGTCGCGCTATGGACATCAATGATAACTGGGTTGGCCTTCCACGGAAATGGCCAGCAAGCTC
TGCAGCTATTCGGAAGAATGCAAGAAGAAGGTGTGACGCCAAACAATGTCACTCTGCTCGCTGTCCTGACAGCTTGCAGT
CATAGCGGACTCGTGGAGGAAGGGCTACACGTTTTCAACCACATGAAGGATAAATTCGGCTTTGACCCTGAAACTGAGCA
TTACGGAAGCCTTGTGGATCTGTTGTGTAGGGCAGGGAGAGTAGAGGAAGCGAAAGACATAGTGCAAAAGAAGATGCCAA
TGAGACCAAGTCAGTCAATGTGGGGATCAATCTTAAGTGCTTGTCGGGGAGGTGAAGACATTGAAACCGCAGAGTTGGCT
TTAACTGAATTGCTTAAGTTGGAACCTGAAAAAGAAGGCGGATACGTTTTGTTGTCTAATATATATGCAACCGTTGGAAG
ATGGGGATATTCAGACAAGACGAGAGAAGCAATGGAGAATCGCGGAGTAAAGAAGACTGCAGGATATAGTAGTGTAGTTG
GAGTAGAGGGACTTCATAGGTTTGTGGCTGCAGAGAAGCAAAACCATCCAAGATGGACGGAGATAAAAAGAATATTGCAG
CATCTGTATAATGAAATGAAGCCAAAATTGGATTGTTTGGACTTGTTAGAAATAGAGATCAAATAG