Details for Arabidopsis Locus AT3G04740

Position : Chr3 ( 5`- 1293807 .. 1300714 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G04740

Protein [Map View]
MAELGQQTVDFSALVGRAAEESFLSFKELVDKSKSTELSDTEKKVSLLKYVAKTQQRMLRLNALAKWCKQVPLINYFQDL
GSTLSAHDICFTQAADSLFFMHEGLQQARAPVYDVPSAVEILLTGSYQRLPKCLDDVGMQSSLDEHQQKPALRKLEVLVR
SKLLEITLPKEITEVKISKGTVTLSVDGEFKVLVTLGYRGHLSMWRILHLDLLVGERSGPIKLEVTRRHILGDDLERRMS
VAENPFTILYAVLHELCVAIVMDTVIRQVRALLQGRWKDAIRFDLISDTGTTPANQEGEADSVSLRTPGMKLFYWSDSDK
NSGPFIKIEPGSDLQIKCSHSTFVIDPLTGKEAEFSLDQSCIDVEKLLLKAICCNRYTRLLEIQKELLRNTRICRTPSDV
ILQALLDEPGIEGDNMVDSKERVEPEVLRVRAYGSSFFTLGINIRTGRFLLQSSKSILTSSILEEFEDALNQGSISAVDA
FINLRSKSILHFFAAIGKFLGLEVYEHGFGINKVPKSLLDGSSILTLGFPDCESSHLLLMELEKDFTPLFKLLETQMDGS
GKPQSFNDPSNILRAKKIDIGQIRILEDDLNLITSDVVKFVSSFSDAEGINQASGHRQPGLVDEALTEMSGSQLSFSSVV
DGVFGLQKVTSALMSIDGHGLVPKNLSAVTGHGKAPMLTSYHSDSLYNRQGPLQSSSYNMLSSPPGKGSAMKKIAISNSD
QELSLILSPSLSTGNGVSESGSRLVTESSLSPLPLSQTADLATSSAGPLLRKDQKPRKRSASDLLRLIPSLQVVEGVASP
NKRRKTSELVQSELVKSWSPASQTLSTAVSTSTKTIGCSYGNLIAEANKGNAPSSVFVYALLHVVRHSSLSIKHAKLTSQ
MEALDIQYVEEMGLRDAFSDIWFRLPFAQNDSWQHICLQLGRPGSMCWDVKINDQHFRDLWELQKGSKTTPWGSGVHIAN
SSDVDSHIRYDPEGVVLSYQSVEADSIKKLVADIQRLSNARMFSLGMRKLLGIKPDEKTEECSANSTMKGSTGGKGSGEP
VDRWRAFKIEAVGLTSLWFSFGSGVLARFVVEWESGKDGCTMHVSPDQLWPHTKFLEDFINGAEVESLLDCIRLTAGPLH
ALAAATRPARASTATGMPVVPATASSRQSNQIQQTQGIIAPSTLAAPNATGQSASATSGNTVASSAPSPLGGGFHGVAML
AAAGRSGPGIVPSSLLPIDVSVVLRGPYWIRIIYRKRFAVDMRCFAGDQVWLQPATPPKGGASIGGSLPCPQFRPFIMEH
VAQELNGLEPNLTGSQGATNPNSGNPTVNGVNRVNFSPSSARAAMNRVASVASGSLVVSSGLPVRRTPGTAVPAHVRGEL
NTAIIGLGDDGGYGGGWVPLVALKKVLRGILKYLGVLWLFAQLPDLLREILGSILKDNEGALLNLDQEQPALRFFVGGYV
FAVSVHRVQLLLQVLSVRRFHHQAQQNGSSAAAQEELTQSEIGEICDYFSRRVASEPYDASRVASFITLLTLPISVLREF
LKLIAWKKGLSQSQQAGEIAPAQRPRIELCLENHSGTDLDNNCAAKSNIHYDRPHNTVDFALTVVLDPVHIPHINAAGGA
AWLPYCVSVRLRYTFGENPSVTFLGMEGSHGGRACWQRVDDWEKCKQRVSRTVEVNGSAAGDLTQGKLKLVADSVQRTLH
LCLQGLREGGNNNNNTHQKEFTI*

DNA
ATGGCGGAATTAGGGCAACAGACGGTGGATTTCTCTGCTCTTGTTGGTCGAGCCGCAGAGGAATCGTTCCTTTCTTTTAA
GGAACTTGTGGATAAGTCTAAGTCGACGGAGCTTTCTGATACTGAGAAGAAGGTTAGCCTCCTTAAGTATGTCGCTAAGA
CTCAGCAACGGATGCTCCGCCTCAATGCCCTCGCCAAGTGGTGTAAACAGGTTCCTCTTATAAACTACTTTCAAGACCTT
GGGAGTACATTATCAGCTCATGACATATGCTTCACACAAGCTGCGGATTCGCTGTTTTTTATGCATGAAGGTCTACAGCA
AGCTCGCGCTCCTGTCTATGACGTTCCCTCTGCTGTTGAGATTTTGCTGACAGGTTCTTATCAGCGCCTGCCAAAGTGTC
TAGATGATGTGGGCATGCAGAGCTCTTTGGATGAGCATCAACAGAAACCAGCTCTAAGAAAGCTGGAGGTACTTGTACGT
TCCAAACTGCTTGAAATCACACTTCCAAAAGAAATAACAGAGGTGAAAATTTCTAAAGGTACAGTTACCTTATCTGTCGA
TGGGGAATTTAAAGTTCTTGTTACTCTTGGTTACCGAGGGCACCTATCCATGTGGCGGATATTGCATTTGGATCTACTTG
TTGGTGAAAGAAGTGGCCCCATTAAACTTGAAGTGACAAGACGGCATATCCTTGGAGATGATTTAGAGCGTCGAATGTCC
GTGGCAGAAAATCCATTCACAATTTTATATGCGGTGCTCCATGAGCTGTGCGTTGCCATTGTCATGGACACAGTCATAAG
ACAGGTCCGAGCTCTTCTGCAGGGGAGATGGAAAGATGCAATTCGCTTCGACTTAATTTCAGATACTGGTACCACACCAG
CGAACCAAGAAGGAGAGGCAGATTCTGTTAGTCTTCGAACGCCAGGAATGAAACTTTTTTACTGGTCAGATTCTGATAAA
AATTCTGGCCCATTTATTAAAATTGAACCAGGGTCAGATCTCCAGATTAAATGTTCTCACAGCACATTTGTAATTGACCC
ACTTACTGGCAAGGAAGCTGAGTTTTCTCTCGACCAGAGCTGCATTGACGTGGAGAAGCTTCTGCTTAAAGCTATATGCT
GTAATAGATATACCCGTCTTCTTGAAATTCAGAAAGAGCTTTTGAGGAATACTCGTATTTGTCGAACTCCAAGTGATGTG
ATCCTTCAAGCCCTCCTGGATGAGCCTGGTATTGAGGGAGATAACATGGTAGACTCTAAAGAGCGAGTAGAGCCAGAGGT
CTTACGAGTGCGAGCCTATGGATCTTCATTTTTCACACTGGGGATAAATATAAGGACTGGTCGGTTTCTTCTACAGTCAT
CCAAGAGTATCTTGACCTCCTCCATCTTGGAGGAATTTGAAGATGCGTTAAACCAAGGAAGTATATCTGCAGTTGATGCC
TTTATCAACTTGAGAAGCAAAAGTATTTTGCATTTTTTTGCTGCTATTGGCAAATTTTTGGGTCTTGAGGTCTATGAACA
TGGTTTTGGTATAAACAAAGTTCCTAAAAGCCTCTTGGATGGGTCAAGCATTCTGACTTTGGGATTCCCTGACTGTGAAA
GCTCTCACCTTTTGCTAATGGAGCTCGAAAAGGACTTCACACCATTGTTTAAATTACTGGAAACTCAGATGGATGGTTCG
GGAAAACCTCAGTCTTTCAATGATCCAAGCAATATTTTGCGAGCTAAGAAAATTGATATAGGGCAGATACGGATTCTCGA
AGATGATCTTAACTTGATTACATCCGATGTGGTTAAATTTGTATCTTCATTCTCGGATGCTGAGGGCATAAATCAAGCAT
CTGGACACCGTCAGCCTGGATTGGTTGACGAGGCTTTGACAGAAATGAGTGGAAGCCAGTTGAGTTTCTCTAGTGTCGTA
GATGGAGTGTTTGGACTTCAGAAAGTGACATCTGCTCTTATGTCAATTGATGGACATGGTTTAGTTCCCAAAAATCTCTC
TGCTGTTACCGGCCATGGAAAAGCTCCAATGTTGACTAGCTATCATTCAGATTCCTTGTATAATCGACAGGGTCCCTTAC
AATCTAGCTCTTATAATATGTTATCATCTCCCCCTGGGAAGGGTTCAGCTATGAAGAAGATAGCCATCTCTAACTCTGAC
CAGGAGTTATCCCTGATACTGTCTCCATCCCTCTCTACTGGGAATGGAGTCTCTGAGTCAGGCTCTAGACTGGTCACTGA
ATCCTCATTGTCACCTCTTCCCCTATCTCAAACAGCTGATCTTGCAACATCATCTGCTGGTCCTTTGTTAAGGAAAGATC
AGAAGCCCCGGAAACGTTCAGCTTCAGATTTGCTAAGATTGATCCCATCCCTCCAGGTAGTGGAAGGTGTTGCTAGTCCC
AATAAGAGAAGAAAAACCTCTGAACTGGTACAGAGTGAATTAGTGAAGAGTTGGAGCCCTGCATCACAGACCTTATCCAC
TGCCGTGTCAACATCAACAAAAACTATAGGATGCAGCTATGGGAATCTCATAGCTGAAGCAAACAAGGGGAATGCACCTT
CAAGCGTTTTTGTTTATGCTCTTCTCCATGTGGTCAGGCATTCTTCGTTGTCCATAAAGCATGCCAAACTAACTAGTCAG
ATGGAGGCATTGGATATTCAATATGTTGAGGAAATGGGACTAAGAGATGCATTTTCAGATATATGGTTCAGGCTTCCATT
TGCTCAAAATGATTCCTGGCAACATATATGCTTGCAGCTTGGTAGACCTGGAAGCATGTGTTGGGATGTGAAAATAAATG
ACCAACACTTTAGGGATCTCTGGGAACTTCAAAAGGGAAGTAAAACCACACCATGGGGTTCTGGAGTTCACATTGCGAAT
TCATCTGATGTTGATTCTCATATCCGTTATGACCCTGAAGGTGTTGTTCTGAGCTATCAGTCTGTGGAAGCCGATAGTAT
AAAGAAGCTTGTGGCCGACATACAAAGGCTTTCAAATGCTAGAATGTTCTCCCTTGGTATGCGGAAACTACTTGGCATAA
AGCCAGATGAAAAAACAGAAGAGTGCAGTGCTAATTCCACTATGAAAGGATCTACTGGAGGAAAAGGCAGTGGTGAGCCA
GTAGATAGGTGGAGAGCTTTCAAGATTGAGGCTGTGGGATTAACAAGCCTGTGGTTTAGCTTTGGTTCAGGCGTTTTGGC
GCGTTTTGTTGTCGAGTGGGAATCAGGTAAAGATGGATGCACCATGCATGTCTCTCCTGACCAACTATGGCCACATACAA
AGTTCTTGGAGGATTTCATAAACGGAGCAGAGGTAGAATCCCTTTTGGATTGCATTCGCCTTACTGCTGGGCCTTTGCAT
GCATTAGCTGCCGCTACTCGCCCTGCCCGAGCTAGTACTGCCACTGGCATGCCTGTTGTACCTGCTACAGCGTCTTCAAG
ACAATCAAATCAGATACAACAAACTCAAGGAATCATTGCCCCTTCAACTTTAGCAGCTCCTAATGCTACTGGCCAGTCTG
CCTCAGCAACTTCAGGAAATACTGTTGCTTCTTCTGCTCCAAGCCCACTTGGTGGAGGTTTCCATGGAGTTGCAATGCTA
GCAGCTGCAGGGAGAAGCGGACCTGGCATCGTTCCAAGCTCTCTCTTGCCCATCGATGTCTCTGTAGTACTCCGTGGACC
CTATTGGATAAGGATCATATACCGTAAACGTTTTGCAGTAGACATGAGATGTTTTGCTGGAGATCAAGTCTGGTTGCAGC
CAGCAACTCCACCCAAGGGTGGTGCTTCTATTGGAGGCTCCTTGCCATGTCCCCAATTCAGACCTTTCATCATGGAGCAT
GTTGCTCAAGAATTGAACGGTTTAGAACCAAATTTGACAGGTAGCCAAGGAGCAACAAATCCCAACAGTGGAAACCCAAC
TGTTAACGGTGTGAACAGAGTTAACTTTTCCCCTTCTAGTGCAAGAGCTGCAATGAATCGAGTAGCCAGTGTTGCTTCAG
GATCTTTAGTGGTTAGCTCAGGATTGCCTGTGCGTAGAACACCAGGCACTGCTGTACCAGCGCATGTAAGAGGTGAATTA
AACACAGCGATAATCGGTTTAGGTGATGACGGTGGCTATGGCGGAGGATGGGTTCCTCTTGTGGCTCTTAAAAAGGTTTT
GCGTGGTATCCTTAAATATCTTGGAGTACTGTGGCTATTTGCTCAGTTACCAGATCTCTTAAGAGAGATCTTGGGTTCCA
TCTTGAAGGATAACGAAGGCGCTCTCTTGAATTTAGACCAAGAACAACCAGCCTTACGCTTCTTTGTCGGTGGCTATGTG
TTTGCGGTGAGTGTCCATAGAGTTCAGCTCCTTCTTCAAGTCCTTAGCGTAAGGCGATTCCATCACCAAGCACAACAAAA
TGGTTCTTCTGCTGCGGCTCAAGAGGAGTTAACCCAATCCGAGATTGGAGAAATCTGCGATTATTTCAGCCGCCGTGTCG
CATCAGAACCGTATGATGCCTCAAGAGTTGCCTCTTTCATAACACTCCTCACGTTACCCATATCGGTCTTGAGAGAGTTT
CTGAAACTGATAGCTTGGAAAAAAGGATTATCCCAATCACAACAAGCTGGAGAGATTGCTCCTGCACAGAGACCTCGAAT
CGAGCTATGTCTAGAGAACCATTCTGGTACAGATTTAGACAACAATTGTGCAGCTAAAAGCAATATCCATTACGACCGGC
CGCACAACACGGTTGACTTTGCGCTAACCGTTGTTCTTGATCCTGTGCACATACCCCATATAAACGCGGCTGGAGGAGCA
GCATGGTTGCCTTACTGTGTATCAGTTAGGTTAAGATACACATTTGGCGAAAATCCTAGCGTGACGTTTCTTGGAATGGA
AGGAAGTCATGGAGGTCGAGCTTGTTGGCAGCGAGTGGACGATTGGGAGAAATGTAAACAGAGAGTGAGCCGTACAGTGG
AAGTCAACGGTTCTGCTGCAGGAGATTTGACTCAGGGAAAACTCAAGTTGGTTGCAGATAGTGTCCAGAGAACATTGCAT
CTATGTCTTCAAGGTCTGAGAGAAGGTGGTAATAATAATAACAACACTCATCAAAAGGAATTTACCATATAG