Details for Arabidopsis Locus AT3G04735

Position : Chr3 ( 5`- 1292408 .. 1292725 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G04735

Protein [Map View]
MSNMKITNRFMLVATFIACVFISSMNMTVGKVIGYPGLKPDLPCDHHRYPSACAPSEQPVNPYRRGCSKIHRCRRDSPPA
PISRKMLIRGQLIYNNAYNAYIQYP*

DNA
ATGAGCAATATGAAAATAACAAATAGGTTTATGCTAGTGGCAACATTCATAGCATGTGTGTTCATAAGCAGCATGAACAT
GACGGTTGGAAAAGTAATTGGGTATCCAGGGTTGAAGCCTGATCTTCCTTGTGATCATCATCGGTATCCTTCTGCATGTG
CACCCTCCGAACAACCAGTGAATCCTTACAGACGGGGATGTAGTAAAATACATAGATGTAGACGCGATTCACCCCCTGCA
CCAATTTCTAGAAAAATGTTAATACGAGGTCAATTAATTTATAATAATGCATATAATGCATATATCCAATATCCATGA