Details for Arabidopsis Locus AT3G04730

Position : Chr3 ( 5`- 1288612 .. 1290602 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G04730

Protein [Map View]
MINFEATELRLGLPGGNHGGEMAGKNNGKRGFSETVDLKLNLSSTAMDSVSKVDLENMKEKVVKPPAKAQVVGWPPVRSF
RKNVMSGQKPTTGDATEGNDKTSGSSGATSSASACATVAYVKVSMDGAPYLRKIDLKLYKTYQDLSNALSKMFSSFTIGN
YGPQGMKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS*

DNA
ATGATTAATTTTGAGGCCACGGAGCTGAGATTAGGGCTACCGGGTGGGAATCACGGAGGAGAAATGGCTGGAAAAAATAA
TGGTAAAAGAGGATTTTCTGAGACTGTTGATCTCAAACTGAATCTTTCATCGACGGCTATGGATTCAGTTTCCAAAGTCG
ATTTAGAGAATATGAAGGAGAAGGTCGTAAAACCACCAGCCAAGGCACAAGTTGTGGGATGGCCACCGGTACGATCTTTC
CGCAAGAACGTCATGTCCGGCCAAAAACCGACCACCGGAGATGCCACCGAAGGAAACGATAAGACTTCTGGCAGCAGTGG
AGCCACCTCATCCGCCTCCGCATGTGCCACCGTGGCTTATGTGAAGGTTAGCATGGACGGTGCACCGTACCTACGGAAAA
TTGACTTGAAACTCTACAAAACTTACCAAGATCTCTCCAACGCCTTAAGCAAAATGTTTAGCTCTTTTACCATAGGCAAC
TATGGACCACAAGGAATGAAAGATTTCATGAATGAGAGTAAATTGATCGATCTTCTAAACGGATCAGATTATGTTCCAAC
ATATGAAGATAAAGATGGCGACTGGATGCTTGTAGGAGACGTACCGTGGGAGATGTTTGTTGATTCATGCAAACGTATAC
GAATAATGAAGGGATCAGAAGCAATCGGACTTGCTCCAAGGGCATTAGAAAAGTGCAAGAACAGAAGTTGA