Details for Arabidopsis Locus AT3G04670

Position : Chr3 ( 5`- 1266242 .. 1268350 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G04670

Protein [Map View]
MEEVEAANRSAIESCHGVLNLLSQRTSDPKSLTVETGEVVSKFKRVASLLTRGLGHGKFRSTNKFRSSFPQHIFLESPIC
CGNDLSGDYTQVLAPEPLQMVPASAVYNEMEPKHQLGHPSLMLSHKMCVDKSFLELKPPPFRAPYQLIHNHQQIAYSRSN
SGVNLKFDGSGSSCYTPSVSNGSRSFVSSLSMDASVTDYDRNSFHLTGLSRGSDQQHTRKMCSGSLKCGSRSKCHCSKKR
KLRVKRSIKVPAISNKIADIPPDEYSWRKYGQKPIKGSPHPRGYYKCSSVRGCPARKHVERCIDETSMLIVTYEGEHNHS
RILSSQSAHT*

DNA
ATGGAGGAAGTTGAAGCTGCTAACAGATCAGCTATAGAAAGCTGTCATGGAGTGTTAAATCTCTTGTCACAACGAACCAG
TGATCCCAAATCCTTAACGGTTGAAACAGGAGAAGTAGTTTCCAAGTTCAAAAGAGTAGCTTCTCTGTTAACTAGAGGGT
TAGGCCATGGAAAGTTTAGGAGTACCAACAAGTTTAGGTCATCTTTTCCTCAACACATCTTCTTAGAGAGTCCTATTTGC
TGCGGTAATGATCTAAGTGGTGATTACACTCAAGTTCTTGCACCAGAGCCACTTCAGATGGTTCCAGCTTCTGCTGTTTA
TAATGAAATGGAGCCAAAACACCAATTGGGTCATCCTTCATTAATGCTTAGTCACAAAATGTGTGTTGACAAGTCGTTTC
TGGAGTTAAAGCCACCTCCTTTTCGTGCTCCTTATCAGTTAATCCACAACCACCAGCAGATAGCTTACTCCAGGAGTAAT
AGCGGTGTAAACCTTAAGTTTGATGGATCTGGTAGTAGTTGCTATACTCCGAGTGTATCAAACGGATCAAGATCATTTGT
GTCATCTCTTAGCATGGATGCTAGTGTAACAGACTACGATAGGAACTCGTTCCATTTGACCGGATTGTCCCGTGGGTCTG
ACCAACAGCATACCCGGAAGATGTGCTCTGGTAGTTTGAAATGCGGAAGTCGAAGCAAATGTCACTGTTCCAAGAAAAGG
AAACTGAGGGTAAAACGATCAATCAAGGTGCCTGCAATCAGTAACAAGATTGCAGACATTCCTCCAGATGAGTATTCTTG
GAGGAAGTATGGACAGAAACCGATAAAGGGTTCACCGCATCCACGGGGATACTATAAATGCAGCAGTGTGAGAGGTTGTC
CAGCAAGGAAGCATGTGGAGCGATGTATTGATGAAACTTCAATGTTAATTGTAACTTACGAAGGCGAGCATAACCATTCA
AGAATATTGTCTTCACAATCAGCTCACACTTGA