Details for Arabidopsis Locus AT3G04660

Position : Chr3 ( 5`- 1264726 .. 1265966 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G04660

Protein [Map View]
MKKRGRKSKKPEEKRAEYDPSSILPLELKIEILMKSPPKSIAKLGFVSNHWSSIIRGQVFTDLYMRRSLAHPRLLFSVYR
PNMQMQFFHSCSQEDPSSDHRSVSYTLNSDLRYSFSPPIGGLIFGQNNTKAMIGNPSTGQFVPLPRIKTQRKHIFSIFGY
DPVNDLYKVLCMTVRTLRGPHYFRWEDPMWEEPMTEEHQVFTLGPKQKWRMLECKYLHRHHSGSQGICRDGVMYYLASFN
DKRSLMSFDLSSEEFNVTKLPEDYILQQFGNMVDHSGKIAIVSQAYSGPMDLWVLEDVSKEEWSKVAAIVPSITDIVGND
QRVIFRGILSTGEIILSLLPTPKPPFFFLCYDPKEKTARKVVIQGIGEDYAAINVFFDHVESHMVLSKLT*

DNA
ATGAAGAAAAGGGGAAGGAAGTCTAAGAAACCAGAAGAAAAAAGAGCTGAATACGACCCGAGTTCGATTCTTCCTCTGGA
ACTGAAAATAGAGATTCTCATGAAGTCACCGCCGAAATCCATAGCCAAGCTAGGTTTCGTTTCAAATCATTGGTCATCGA
TAATCCGCGGCCAAGTTTTCACCGACTTGTACATGAGACGATCTTTGGCTCATCCACGACTTCTTTTCTCAGTGTACCGT
CCCAACATGCAGATGCAGTTCTTTCACTCCTGCTCTCAGGAAGATCCGTCTTCTGATCATCGTAGCGTCAGTTACACTCT
GAATTCAGATCTACGGTACTCATTTTCTCCACCCATCGGCGGTTTGATATTCGGTCAAAACAATACTAAAGCTATGATTG
GAAACCCTAGTACGGGTCAGTTTGTACCTTTACCTAGAATCAAAACGCAGAGAAAGCACATTTTCTCCATTTTTGGATAT
GATCCAGTTAATGATTTGTACAAAGTCTTGTGTATGACGGTAAGAACTCTACGTGGACCACATTATTTTAGATGGGAAGA
TCCTATGTGGGAGGAGCCTATGACAGAGGAGCATCAAGTTTTCACGCTAGGACCCAAACAAAAATGGAGAATGCTCGAAT
GTAAGTATCTACATCGTCATCATTCTGGATCTCAAGGGATATGTAGAGATGGGGTGATGTATTATTTAGCTTCTTTCAAC
GATAAACGATCTCTGATGAGCTTTGATCTGAGCTCTGAAGAATTTAATGTTACTAAGCTACCTGAGGATTATATATTACA
ACAGTTTGGTAATATGGTGGACCATAGTGGAAAGATAGCTATAGTGAGTCAGGCATACAGCGGTCCAATGGACCTGTGGG
TTCTTGAAGATGTCAGCAAAGAAGAGTGGTCAAAAGTTGCTGCCATAGTTCCTTCTATTACAGATATAGTTGGGAATGAT
CAAAGAGTCATTTTCAGGGGTATACTTTCTACTGGTGAGATTATACTTTCACTGCTCCCAACCCCCAAGCCGCCCTTCTT
TTTTCTCTGTTACGATCCCAAGGAAAAAACTGCTAGAAAAGTTGTGATTCAAGGAATTGGAGAAGACTATGCTGCTATTA
ATGTCTTTTTCGATCACGTAGAGAGTCATATGGTTCTGTCGAAGCTAACTTAA