Details for Arabidopsis Locus AT3G04650

Position : Chr3 ( 5`- 1261984 .. 1264622 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G04650

Protein [Map View]
MATSLMSLSSSFLQPLKLKTLAQPRNTDLSTTRKIITTCDSQNNTGKSNPSSRNPNFQKRRNSSKYGTSRRSILKKSFLQ
EQVTFTARVSDDPHVAIIGGGMAGLVCALNLEARGVQSTVFDTGIHGLGGRLGTRIIEPQGLIFDHAAQFFTADDSRFIK
LVDGWLEKGLVREWKGAVGELEIGGSFSQFPSSSPPRYIAANGMRSLADSLLLESQMVNLVRPCWISKLEPLNGMWHLSE
NGTPRGQFDVIVIAHNGKCANRLLSASGLPLVAKQMKKLDLSSIWALLAAFDDPLPTVNFEGAFVKGVESLSWMGNNSAK
LGNGRTPPHCWTFFSTAAYGKQNKVPQENIPTVTAEKVKAGMLQGVEIALGLPEGSLPKPVYTRLQLWGAALPKNTPAVP
CIFDPQGRAGICGDWLLGSNLESAAISGAALGNHIAEFLQNGEANPEEFAIGLHDRLSPLAGHDIGQFPGLTSVGEKEEA
NAYQLL*

DNA
ATGGCCACTTCTTTAATGTCTCTGTCTTCTTCATTTCTTCAACCTCTGAAACTCAAAACCCTAGCACAACCCAGAAACAC
TGACTTATCTACCACCAGAAAAATCATAACAACATGCGATTCCCAAAACAACACTGGTAAGTCAAACCCCAGCAGCAGAA
ACCCTAATTTCCAGAAACGGCGAAACTCCTCCAAGTATGGGACTTCTAGAAGGTCGATCCTCAAGAAATCGTTTTTACAA
GAGCAAGTTACTTTCACCGCACGGGTCTCTGATGACCCCCACGTGGCAATTATCGGTGGAGGAATGGCGGGTTTGGTCTG
CGCATTGAACCTGGAAGCTCGTGGCGTCCAGTCCACAGTTTTCGATACGGGGATACATGGGTTAGGAGGAAGACTTGGAA
CAAGAATTATTGAACCACAGGGACTAATTTTCGATCACGCTGCTCAATTCTTCACCGCGGATGATTCTCGGTTTATCAAA
TTGGTCGATGGGTGGTTAGAGAAAGGACTTGTTCGAGAGTGGAAAGGTGCCGTGGGAGAGCTTGAAATTGGAGGTAGCTT
CTCACAGTTTCCCTCATCATCACCTCCAAGATACATTGCTGCTAATGGCATGCGATCTCTCGCTGATTCTTTGCTATTAG
AGAGTCAAATGGTGAATCTGGTAAGGCCTTGTTGGATCAGTAAGTTGGAACCACTTAATGGTATGTGGCATTTAAGTGAG
AATGGAACACCTCGTGGTCAGTTTGATGTCATAGTTATTGCTCATAATGGTAAATGCGCCAATCGCTTGCTTTCAGCATC
AGGCTTGCCCCTAGTGGCTAAACAGATGAAGAAACTGGATTTGAGTTCAATATGGGCGCTATTAGCAGCTTTTGATGATC
CTCTTCCCACAGTGAACTTTGAGGGAGCGTTTGTGAAAGGAGTTGAATCACTGTCTTGGATGGGAAATAACTCTGCAAAG
CTTGGAAATGGCAGAACTCCACCACATTGTTGGACTTTTTTCAGTACTGCGGCATATGGGAAACAGAACAAAGTTCCTCA
GGAAAACATCCCAACGGTCACGGCAGAGAAAGTTAAAGCCGGGATGCTTCAAGGTGTGGAAATCGCATTGGGGTTGCCTG
AAGGCTCACTTCCTAAACCGGTTTATACACGTCTCCAGCTATGGGGAGCAGCTTTGCCGAAGAACACTCCTGCAGTTCCA
TGTATATTTGATCCACAAGGCCGTGCTGGTATATGCGGTGATTGGCTTCTCGGTTCTAACTTAGAATCTGCAGCTATAAG
CGGTGCAGCCTTAGGAAACCATATTGCGGAATTCTTACAGAACGGTGAAGCTAATCCAGAAGAATTTGCAATCGGTTTAC
ATGATAGGTTAAGTCCTCTTGCTGGCCATGATATTGGTCAGTTTCCTGGTTTAACATCAGTGGGAGAAAAGGAAGAAGCT
AATGCATATCAGCTGCTGTGA