Details for Arabidopsis Locus AT3G04640

Position : Chr3 ( 5`- 1260906 .. 1261683 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G04640

Protein [Map View]
MDLKKASLFLFLLLCLHLQLQHHFAHAVSRSSTSLAFVDPNHDDLPFQEVELKPDGDVIEANLPKLTVVVKKGGGGGGRG
GGGFGGGGRSFGGGGSSSRGGGGSSSRGGGGSSSRGGGLRPIPIYGGGTHRSGHHSSGGRETASGWLGLSILAGLGLVF*

DNA
ATGGATTTGAAGAAAGCATCTTTGTTTTTATTCCTTCTTCTCTGTCTCCACCTGCAACTGCAACACCACTTTGCTCACGC
GGTCTCGCGATCTTCAACAAGTTTAGCCTTCGTTGATCCAAACCATGATGATCTCCCGTTTCAAGAAGTAGAATTGAAGC
CAGACGGTGACGTAATCGAAGCCAATTTACCGAAATTAACAGTCGTTGTTAAGAAAGGCGGCGGAGGAGGAGGCAGAGGT
GGAGGCGGTTTCGGCGGAGGGGGACGCAGTTTCGGCGGAGGAGGGAGTTCTAGCAGAGGCGGTGGAGGAAGTTCTAGCAG
AGGCGGAGGAGGGAGTTCTAGCAGAGGAGGAGGATTACGTCCGATTCCGATTTATGGCGGTGGAACGCACCGCAGTGGTC
ATCATTCAAGCGGCGGCCGGGAAACTGCTAGTGGTTGGTTAGGTCTATCGATTTTAGCCGGTTTAGGTTTGGTTTTTTAA