Details for Arabidopsis Locus AT3G04620

Position : Chr3 ( 5`- 1255526 .. 1256869 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G04620

Protein [Map View]
MAMEVATPAPAPIPSERNIVLAPATTTTTATVETHKKNRIQVSNTKKPLFFYVNLAKRYIQQHNEVELSALGMAITTVVT
ISEILKNNGLATEKKVLTSTVGMKDETKGKMVQKAKIEIVLGKSDKFDSLVPPVTNGKTPEEEASAETEASVEAQEEVAA
ATEV*

DNA
ATGGCGATGGAAGTAGCAACACCGGCTCCGGCACCAATCCCATCGGAGAGGAACATCGTTCTCGCGCCTGCAACAACAAC
AACAACCGCCACTGTTGAGACTCACAAGAAGAACAGGATCCAAGTTTCCAACACCAAGAAGCCATTGTTCTTCTACGTTA
ATCTCGCCAAGAGGTACATTCAGCAACACAACGAGGTCGAGCTTTCTGCACTTGGAATGGCAATCACAACTGTGGTAACA
ATCTCTGAGATCTTGAAGAACAATGGACTTGCAACAGAGAAGAAGGTGCTAACATCGACTGTGGGAATGAAAGATGAGAC
AAAAGGGAAGATGGTCCAGAAGGCAAAGATTGAGATAGTGTTGGGCAAGTCAGACAAGTTTGACTCTTTGGTGCCACCTG
TGACCAACGGCAAGACTCCGGAGGAGGAAGCCAGTGCAGAGACGGAAGCTTCCGTGGAAGCACAAGAAGAAGTTGCCGCT
GCCACCGAGGTCTAG