Details for Arabidopsis Locus AT3G04610

Position : Chr3 ( 5`- 1250553 .. 1254873 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G04610

Protein [Map View]
MAEAEDQQNFVAHNGDQVPDQGSDELHNGLPYQVHDETLVHQPYEVEDPILEPQQYEVPDPTLEPQQYEVPDQTLEPQQY
EVDDQLEYHQYQLQDQANEDVQDHSQDDLQYQPQNQEQFQLQDEAHDQAQYQAQGDVQDHNGDEVQDKVEDEEGIPEHLE
SLQKSEPEEDATVGGEEKRWPGWPGETVFRMLVPAQKVGSIIGRKGDVIKKIVEETRARIKILDGPPGTTERAVMVSGKE
EPESSLPPSMDGLLRVHMRIVDGLDGEASQAPPPSKVSTRLLVPASQAGSLIGKQGGTVKAIQEASACIVRVLGSEDLPV
FALQDDRVVEVVGEPTSVHRALELIASHLRKFLVDRSIIPFFENQMQKPTRQMDHMPPPHQSWGPPQGHAPSVGGGGYGH
NPPPYMQPPPRHDSYYPPPEMRQPPMEKQPHQGISAYGREPPMNVHVSSAPPMVAQQVTQQMQIPLSYADAVIGTSGSNI
SYTRRLSGATVTIQETRGVPGEMTVEVSGTGSQVQTAVQLIQNFMAEAGAPAPAQPQTVAPEQQGYNPYATHGSVYAAAP
TNPPGGYATDYSSGYGY*

DNA
ATGGCTGAAGCTGAAGATCAGCAAAATTTCGTTGCACACAATGGAGATCAGGTACCAGATCAAGGGTCAGATGAGTTGCA
TAATGGGTTACCGTACCAGGTTCATGATGAGACCCTTGTTCACCAACCATACGAGGTTGAAGATCCGATTCTTGAACCTC
AGCAGTACGAGGTACCAGATCCGACTCTTGAACCACAGCAGTACGAGGTACCAGATCAGACTCTTGAACCTCAGCAGTAC
GAGGTTGATGATCAGTTAGAGTATCATCAATACCAGTTGCAGGACCAGGCTAATGAAGATGTCCAAGATCATTCGCAAGA
TGACCTACAATATCAGCCACAAAATCAGGAGCAGTTTCAGTTACAAGACGAGGCTCATGATCAGGCTCAGTATCAGGCGC
AAGGTGATGTACAAGATCACAATGGTGATGAAGTGCAAGATAAAGTAGAAGATGAGGAAGGAATTCCTGAGCATCTTGAG
TCTCTACAGAAATCAGAGCCTGAAGAAGATGCGACAGTTGGAGGTGAGGAGAAGAGGTGGCCGGGATGGCCCGGAGAGAC
GGTATTCCGTATGCTGGTTCCTGCACAGAAAGTGGGTAGCATCATTGGTCGCAAAGGTGATGTCATTAAGAAAATAGTTG
AGGAGACAAGGGCTCGAATAAAGATTCTCGATGGTCCTCCAGGCACAACAGAAAGAGCTGTTATGGTTTCTGGTAAAGAA
GAGCCCGAATCATCTCTACCACCTTCTATGGATGGCCTTCTTAGAGTCCACATGCGGATAGTTGATGGTTTGGATGGTGA
AGCTTCTCAAGCCCCTCCGCCTTCAAAGGTGTCAACAAGATTACTAGTCCCAGCATCTCAGGCTGGAAGTTTGATTGGAA
AACAGGGAGGAACAGTTAAAGCTATTCAAGAAGCATCCGCTTGTATAGTCAGAGTTCTTGGATCAGAGGATTTACCTGTT
TTTGCTCTTCAAGACGATAGGGTTGTTGAAGTTGTGGGGGAACCAACAAGTGTTCATAGAGCCTTGGAGCTGATTGCGTC
ACATCTCAGAAAGTTCTTGGTTGATCGTAGCATCATCCCATTCTTTGAAAATCAGATGCAAAAGCCAACTCGCCAAATGG
ACCATATGCCACCACCACACCAGTCATGGGGTCCTCCTCAAGGTCATGCCCCAAGTGTTGGTGGAGGAGGCTATGGTCAC
AACCCACCTCCATATATGCAACCACCTCCTAGACATGATAGTTACTATCCTCCTCCTGAGATGCGTCAACCTCCAATGGA
GAAACAGCCTCATCAAGGTATATCTGCATATGGTAGAGAGCCTCCTATGAATGTGCACGTATCATCAGCCCCACCAATGG
TCGCTCAGCAAGTTACGCAGCAAATGCAGATTCCACTGTCTTATGCTGATGCTGTAATTGGGACGTCGGGTTCAAACATA
AGCTACACTAGACGTCTTAGTGGAGCAACAGTAACTATTCAGGAGACCAGGGGAGTACCTGGTGAAATGACTGTTGAGGT
TAGCGGAACTGGCTCACAAGTCCAAACTGCCGTGCAGCTTATTCAGAACTTCATGGCTGAAGCTGGAGCGCCGGCACCAG
CACAGCCTCAAACTGTAGCACCAGAGCAGCAAGGCTATAACCCATACGCAACACACGGCTCAGTTTACGCAGCGGCTCCA
ACAAACCCGCCTGGAGGATACGCTACGGATTACAGCTCAGGCTACGGTTACTGA