Details for Arabidopsis Locus AT3G04600

Position : Chr3 ( 5`- 1242973 .. 1246211 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G04600

Protein [Map View]
MEVDKKDEREAESSEQVVNPWEVSAKDGGKIDYDKLIDKFGCQRLDESLIDRVQRLTSRQPHVFLRRSVFFAHRDFNEIL
DAYERGDKFYLYTGRGPSSEALHLGHLIPFMFTKYLQEAFKVPLVIQLTDDEKSIWKNLSVEESQRLARENAKDIIACGF
DVTKTFIFSDFDYVGGAFYKNMVKVGKCVTLNKAMGIFGFSGEDPIAKLSFPPVQAVPSFPSSFPHLFPGKDNLRCLIPC
AIDQDPYFRMTRDVAPRLGYSKPALIESTFFPALQGENGKMSASDPNSAIYVTDSAKDIKNKINRYAFSGGQDSIEKHRE
LGANLEVDIPVKYLSFFLEDDSELEHIKKEYGEGRMLTGEVKKRLTEVLTEIVERHRRARAAVTDEMVDAFMAVRPLPSM
FE*

DNA
ATGGAGGTGGATAAGAAGGACGAGAGAGAGGCTGAATCTTCGGAGCAAGTGGTGAATCCATGGGAAGTGTCCGCCAAAGA
CGGCGGGAAGATCGATTACGACAAGCTTATTGACAAATTTGGATGTCAAAGGCTTGACGAGTCACTGATTGATCGTGTTC
AGAGACTGACTTCTCGTCAACCACACGTGTTCCTCCGCCGTAGTGTCTTCTTCGCCCACCGGGATTTCAATGAGATTTTG
GACGCTTATGAGAGAGGAGACAAGTTCTATCTCTACACTGGAAGAGGACCTTCATCAGAAGCATTGCATTTGGGGCATTT
GATTCCTTTCATGTTTACCAAATACTTGCAAGAAGCTTTCAAGGTTCCCCTTGTTATACAGCTCACGGATGATGAAAAAA
GTATATGGAAGAACTTATCGGTGGAGGAAAGTCAAAGACTTGCCAGAGAAAATGCGAAAGATATTATTGCTTGTGGATTC
GATGTAACAAAGACCTTCATTTTCTCGGACTTCGACTATGTTGGCGGTGCTTTCTATAAAAATATGGTGAAGGTTGGCAA
GTGCGTTACACTTAATAAGGCTATGGGAATCTTTGGCTTTTCCGGTGAAGATCCTATCGCGAAACTCAGTTTCCCTCCTG
TGCAGGCAGTTCCATCTTTTCCTAGCTCATTCCCACATTTGTTCCCTGGCAAGGACAATCTCCGCTGCTTGATTCCTTGT
GCTATTGACCAGGATCCTTATTTTAGAATGACTCGTGATGTCGCACCCCGGTTAGGCTATAGCAAGCCCGCCCTGATTGA
GTCAACATTTTTTCCTGCGTTGCAGGGAGAGAATGGAAAAATGTCTGCTAGTGATCCAAATTCTGCTATCTATGTGACTG
ATTCCGCAAAGGACATTAAAAACAAGATAAACAGATATGCGTTTAGTGGTGGGCAAGACTCCATTGAGAAGCACCGAGAA
CTTGGAGCAAATCTCGAGGTTGACATACCCGTCAAGTATCTGAGTTTCTTCCTCGAAGACGATTCTGAACTAGAACACAT
TAAAAAGGAATATGGAGAAGGAAGAATGCTAACAGGAGAAGTAAAGAAGAGACTTACGGAAGTGTTGACAGAAATTGTGG
AGAGACACCGCAGGGCTCGAGCTGCTGTTACTGATGAGATGGTTGATGCGTTCATGGCGGTGAGACCTCTCCCAAGCATG
TTCGAATAG