Details for Arabidopsis Locus AT3G04590

Position : Chr3 ( 5`- 1238853 .. 1241640 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G04590

Protein [Map View]
MDPNESHHHHQQQQLHHLHQQQQQQQQQQRLTSPYFHHQLQHHHHLPTTVATTASTGNAVPSSNNGLFPPQPQPQHQPND
GSSSLAVYPHSVPSSAVTAPMEPVKRKRGRPRKYVTPEQALAAKKLASSASSSSAKQRRELAAVTGGTVSTNSGSSKKSQ
LGSVGKTGQCFTPHIVNIAPGEDVVQKIMMFANQSKHELCVLSASGTISNASLRQPAPSGGNLPYEGQYEILSLSGSYIR
TEQGGKSGGLSVSLSASDGQIIGGAIGSHLTAAGPVQVILGTFQLDRKKDAAGSGGKGDASNSGSRLTSPVSSGQLLGMG
FPPGMESTGRNPMRGNDEQHDHHHHQAGLGGPHHFMMQAPQGIHMTHSRPSEWRGGGNSGHDGRGGGGYDLSGRIGHESS
ENGDYEQQIPD*

DNA
ATGGATCCTAACGAAAGCCACCATCACCACCAACAACAACAGCTCCATCACCTCCACCAACAGCAACAGCAACAGCAGCA
GCAGCAACGACTCACTTCTCCTTACTTCCACCACCAACTACAGCACCATCACCACCTTCCAACCACCGTAGCAACCACCG
CTTCTACCGGAAACGCCGTTCCATCTTCCAACAATGGGCTTTTCCCTCCGCAGCCTCAGCCACAGCACCAGCCTAATGAT
GGGTCATCTTCTCTCGCGGTGTACCCTCATTCAGTTCCGTCCTCGGCTGTGACGGCGCCGATGGAGCCGGTAAAGAGGAA
GAGGGGTCGACCAAGAAAGTATGTGACGCCGGAACAAGCCCTAGCGGCTAAGAAATTGGCGTCTTCTGCGAGTAGTTCGT
CTGCTAAACAGAGGCGAGAGCTTGCTGCTGTTACCGGTGGTACGGTATCGACTAATTCCGGGTCATCCAAGAAATCTCAG
CTTGGTTCTGTCGGGAAAACTGGACAATGTTTTACTCCGCATATTGTTAATATAGCTCCTGGCGAGGATGTGGTCCAGAA
AATTATGATGTTCGCAAACCAAAGCAAGCATGAACTATGCGTTCTTTCTGCATCAGGCACTATCTCTAATGCATCCTTGC
GCCAACCGGCTCCATCAGGAGGCAACTTACCATATGAGGGTCAATACGAGATTCTCTCACTATCTGGATCCTATATCCGA
ACTGAACAAGGTGGTAAATCCGGCGGCCTTAGCGTTTCTTTATCTGCTTCAGATGGTCAGATCATCGGTGGAGCGATTGG
TAGCCATCTCACAGCTGCTGGCCCGGTTCAGGTGATTCTTGGTACGTTTCAGCTTGATAGAAAGAAGGATGCCGCCGGGA
GTGGTGGGAAAGGGGATGCTTCAAACAGTGGAAGTCGGTTAACTTCTCCTGTAAGCTCTGGACAGTTGCTTGGCATGGGT
TTCCCTCCTGGTATGGAATCTACGGGAAGAAATCCAATGAGGGGAAACGACGAGCAACATGATCATCATCATCATCAAGC
CGGTTTGGGTGGACCTCATCATTTCATGATGCAAGCGCCGCAGGGGATACACATGACACATTCCAGGCCATCTGAATGGC
GCGGAGGAGGCAACAGCGGTCATGATGGCAGAGGCGGTGGCGGGTATGATTTGTCAGGAAGGATAGGACATGAGTCGTCG
GAGAATGGAGATTACGAGCAGCAAATACCGGATTAG