Details for Arabidopsis Locus AT3G04560

Position : Chr3 ( 5`- 1227360 .. 1229408 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G04560

Protein [Map View]
MAENLFSGLPPPSSSQQQELPISPIPDESKIETSSPAPILVLKSALKRSKPEESAPNLSAPPVLKSALKRSKPSESTPEP
VPEPEAPKKRLQFKTSTDASEEQVIEAMQKITSHIKNPSKFSKASKLAIRLIQAGSVKPETSSYFIAILEAAMSSKTPCT
DRSVRADYHALFSAAQDVAECLDKSQKNLLTIWTFKAVVANDLFTDDSFMFSKTATRIKEAISDLPVSTEEDDVEEAAAL
EEAAVKDNGDGQTTQDVAEAASAGDNEAVESDPFGLDAWIPSSGKKNGKTKIKRTNEDPDAEENKRFLRSKREALITCLE
IAARRYKVPWCQTVIDILVKHAFENVSRFTSQQRQAVEKLWASVREQHLRRKQGKSVTGKLDVTAFESLQDKYANEKMSI
RSSVGASGERRAQQWLG*

DNA
ATGGCGGAAAATCTATTCTCAGGGCTGCCACCTCCTTCTTCATCTCAGCAGCAAGAGCTACCAATTTCTCCAATACCAGA
CGAGTCAAAGATTGAAACTTCCTCTCCAGCTCCGATTCTGGTTCTCAAGAGTGCCCTAAAGCGATCGAAGCCAGAAGAAT
CTGCACCCAATCTTTCAGCTCCTCCTGTTCTCAAGAGCGCACTAAAGCGGTCAAAACCATCAGAATCTACTCCGGAACCA
GTACCAGAACCGGAAGCTCCTAAAAAGCGTCTACAGTTTAAGACATCAACCGATGCATCAGAGGAACAAGTGATAGAAGC
TATGCAGAAGATAACATCTCATATCAAGAACCCTTCCAAATTCTCCAAAGCCTCGAAGCTTGCTATACGGCTGATCCAAG
CTGGTAGTGTGAAGCCAGAAACAAGCAGCTATTTTATTGCGATACTTGAAGCTGCCATGTCGTCTAAAACTCCTTGTACA
GATCGCTCGGTTCGAGCAGACTATCATGCATTGTTCTCGGCAGCTCAGGATGTAGCCGAGTGCCTTGATAAAAGCCAGAA
GAATCTGTTGACCATATGGACATTCAAAGCAGTTGTGGCTAATGACCTCTTCACTGATGACAGCTTTATGTTTTCCAAGA
CTGCTACTCGTATAAAGGAGGCTATATCTGATCTTCCGGTTTCAACCGAGGAGGATGATGTGGAAGAAGCAGCTGCTCTT
GAAGAAGCAGCGGTGAAAGACAATGGAGATGGCCAGACAACGCAGGACGTGGCTGAAGCTGCTTCAGCTGGAGATAATGA
GGCTGTCGAGTCTGATCCATTTGGACTAGATGCCTGGATTCCCAGTTCTGGAAAGAAAAATGGTAAAACAAAGATAAAGA
GAACAAATGAAGATCCAGATGCCGAAGAGAATAAGAGGTTTCTCAGGTCAAAAAGAGAAGCTTTGATTACATGCTTGGAG
ATTGCTGCACGCCGTTACAAAGTTCCATGGTGCCAAACAGTTATAGACATATTGGTGAAACATGCCTTTGAGAACGTGTC
AAGGTTCACATCACAGCAGAGACAAGCAGTGGAGAAACTCTGGGCTTCTGTTCGAGAACAACATCTCCGTAGGAAGCAAG
GCAAATCAGTCACAGGAAAACTAGACGTTACAGCTTTTGAATCGCTTCAGGATAAATACGCCAACGAGAAAATGAGCATC
CGAAGCTCAGTTGGAGCCAGCGGTGAACGCCGTGCACAGCAATGGCTCGGTTAA