Details for Arabidopsis Locus AT3G04520

Position : Chr3 ( 5`- 1217239 .. 1219771 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G04520

Protein [Map View]
MVTPTTIRTVDLRSDTVTKPTESMRSAMANAEVDDDVLGNDPTALRLEKEVAEIAGKEAAMFVPSGTMGNLISVLVHCDE
RGSEVILGDDSHIHIYENGGVSSLGGVHPRTVKNEEDGTMEIGAIEAAVRSPKGDLHHPVTKLICLENTQANCGGRCLPI
EYIDKVGELAKKHGLKLHIDGARIFNASVALGVPVKRIVQAADSVSICLSKGIGAPVGSVIVGSKKFITKARWLRKTLGG
GMRQIGVLCAAALVALHENVAKLEDDHKKARVLAEGLNRIERLRVNVAAVETNIIYVDIPEDPKFGAEEACKSLEDVGVL
VIPQATFRIRIVLHHQISDVDVEYVLSCFEKIFHS*

DNA
ATGGTGACGCCAACTACAATTAGAACCGTCGATCTCCGCTCCGACACGGTGACTAAACCAACAGAGTCAATGCGTTCAGC
AATGGCAAACGCGGAAGTAGACGACGACGTTTTGGGAAACGATCCAACGGCTCTGCGTTTGGAGAAAGAGGTGGCTGAGA
TCGCTGGAAAAGAGGCGGCGATGTTTGTTCCGTCAGGGACAATGGGGAATCTGATAAGCGTGTTGGTCCATTGTGATGAG
AGAGGGAGTGAAGTGATTCTTGGAGACGACTCTCACATTCATATATATGAAAACGGCGGCGTTTCAAGCCTCGGTGGTGT
GCATCCGAGGACGGTGAAGAATGAGGAAGACGGTACGATGGAGATTGGTGCTATTGAAGCTGCCGTGAGGAGTCCCAAAG
GAGATCTCCATCATCCGGTTACTAAGCTTATATGTCTTGAGAATACTCAAGCAAATTGTGGAGGTAGATGCCTTCCTATA
GAATATATAGACAAAGTCGGAGAATTAGCCAAGAAACATGGTTTGAAGCTTCACATTGACGGAGCTAGGATTTTCAACGC
TTCTGTGGCACTTGGAGTTCCCGTGAAGAGGATTGTTCAAGCAGCTGATTCTGTCTCGATCTGTTTGTCGAAAGGTATTG
GTGCACCGGTCGGTTCGGTAATCGTGGGAAGCAAGAAGTTCATTACTAAAGCAAGGTGGTTAAGGAAAACATTAGGCGGA
GGAATGAGACAGATCGGCGTGCTCTGCGCCGCCGCATTGGTGGCTCTCCATGAAAACGTCGCCAAGCTCGAAGATGACCA
TAAGAAAGCCAGGGTTTTGGCAGAAGGACTGAACCGGATTGAACGGTTAAGAGTGAACGTTGCAGCTGTGGAAACCAACA
TCATATACGTAGACATACCAGAAGATCCAAAATTTGGAGCAGAAGAGGCATGTAAGAGCTTGGAAGATGTCGGTGTGCTT
GTCATACCCCAAGCTACATTCAGAATCAGGATTGTTCTACACCACCAAATCTCAGACGTCGACGTGGAATATGTACTCTC
TTGCTTTGAGAAAATATTTCACTCGTGA