Details for Arabidopsis Locus AT3G04510

Position : Chr3 ( 5`- 1215636 .. 1216958 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G04510

Protein [Map View]
MDLISQNHNNRNPNTSLSTQTPSSFSSPPSSSRYENQKRRDWNTFCQYLRNHHPPLSLASCSGAHVLDFLRYLDQFGKTK
VHHQNCAFFGLPNPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGAPETSPFGSRSVRIFLREVRDFQAKSRGVSYEKKR
KRVNNKQITQSQPQSQPPLPQQPQQEQGQSMMANYHHGATQ*

DNA
ATGGATTTGATCTCTCAAAACCACAACAACAGAAACCCTAATACCAGTCTCTCGACGCAAACCCCTTCTTCCTTTTCTTC
TCCACCTTCCTCTAGCCGCTACGAGAACCAGAAACGCCGTGACTGGAACACTTTCTGCCAATACCTCAGAAACCACCATC
CACCGCTCTCTCTAGCTTCTTGCAGTGGCGCACACGTCCTCGATTTTCTGCGTTACCTTGACCAATTCGGCAAAACCAAA
GTCCACCACCAAAACTGCGCCTTCTTTGGCCTCCCAAATCCACCGGCTCCTTGTCCTTGTCCTCTCCGACAAGCCTGGGG
CTCACTCGACGCCCTCATTGGTCGTCTCCGTGCAGCCTACGAGGAGAACGGTGGCGCTCCCGAGACTAGCCCTTTTGGCT
CACGGTCCGTCAGGATTTTCCTCAGGGAGGTTAGAGATTTCCAGGCTAAGTCACGTGGTGTTAGCTATGAGAAGAAGAGG
AAAAGGGTCAACAACAAGCAAATAACTCAGTCCCAACCACAGTCCCAACCGCCTTTACCCCAGCAGCCACAGCAGGAGCA
AGGTCAGTCTATGATGGCTAATTACCACCACGGTGCAACTCAATAA