Details for Arabidopsis Locus AT3G04500

Position : Chr3 ( 5`- 1211762 .. 1213855 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G04500

Protein [Map View]
MSIPPSSGSSSSSSSSQYTYAANSYYSAPYQPPQPYAAAPSPAVPAPVASIPGATVYPQPVGPVPAVYAYPQYQQAHQLF
QRDAQTITPEALENVKAALASSETEHKAETKKRAIPRKAAGQSWEDPTLSEWPENDYRLFCGDLGNEVNDDVLSKAFARF
PTFNMAKVIRDKRTGKTKGYGFVSFLNPADLAAALKEMNGKYVGNRPIKLRKSSWKERTDQEAAERQKHHSNKKQKTVKK
SILHK*

DNA
ATGTCAATCCCACCATCTTCAGGTTCTTCTTCTTCATCTTCCTCGTCTCAGTACACATACGCAGCTAATTCTTACTATTC
CGCTCCGTATCAGCCTCCACAGCCTTACGCGGCGGCGCCTTCGCCTGCTGTACCGGCGCCTGTGGCATCCATTCCCGGAG
CTACGGTCTATCCTCAGCCTGTTGGACCGGTTCCTGCCGTCTACGCTTACCCTCAGTACCAACAGGCACATCAATTGTTC
CAAAGAGATGCACAGACAATTACACCAGAAGCTCTTGAGAATGTAAAAGCTGCTTTGGCAAGTAGTGAAACCGAACACAA
AGCAGAAACTAAAAAGAGAGCCATTCCTCGTAAAGCTGCTGGACAGTCTTGGGAGGATCCTACTCTTTCAGAATGGCCAG
AAAATGACTATCGTCTGTTCTGTGGTGATCTTGGGAACGAAGTGAATGATGATGTTCTTTCCAAAGCATTTGCTAGATTC
CCCACCTTCAATATGGCCAAGGTCATTAGAGATAAGCGGACTGGTAAAACCAAGGGTTATGGGTTTGTGAGTTTCTTAAA
TCCTGCGGATCTAGCAGCAGCCTTAAAAGAAATGAATGGTAAGTATGTTGGAAATCGTCCGATAAAACTACGAAAGAGTA
GCTGGAAAGAGAGAACAGATCAGGAGGCTGCTGAAAGACAAAAGCATCACAGCAATAAGAAGCAAAAAACTGTGAAGAAG
AGCATACTTCACAAGTGA