Details for Arabidopsis Locus AT3G04380

Position : Chr3 ( 5`- 1161387 .. 1164929 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G04380

Protein [Map View]
MISLSGLTSSVESDLDMQQAMLTNKDEKVLKALERTRQLDIPDEKTMPVLMKLLEEAGGNWSYIKLDNYTALVDAIYSVE
DENKQSEGSSNGNRGKNLKVIDSPATLKKTYETRSASSGSSIQVVQKQPQLSNGDRKRKYKSRIADITKGSESVKIPLVD
DVGSEAVPKFTYIPHNIVYQSAYLHVSLARISDEDCCANCKGNCLSADFPCTCARETSGEYAYTKEGLLKEKFLDTCLKM
KKEPDSFPKVYCKDCPLERDHDKGTYGKCDGHLIRKFIKECWRKCGCDMQCGNRVVQRGIRCQLQVYFTQEGKGWGLRTL
QDLPKGTFICEYIGEILTNTELYDRNVRSSSERHTYPVTLDADWGSEKDLKDEEALCLDATICGNVARFINHRCEDANMI
DIPIEIETPDRHYYHIAFFTLRDVKAMDELTWDYMIDFNDKSHPVKAFRCCCGSESCRDRKIKGSQGKSIERRKIVSAKK
QQGSKEVSKKRK*

DNA
ATGATCAGTCTCTCCGGACTAACCAGTTCTGTTGAAAGTGATCTCGATATGCAACAAGCGATGCTCACCAATAAAGACGA
GAAGGTACTCAAAGCTTTAGAGAGAACAAGGCAATTGGATATTCCCGATGAAAAGACAATGCCAGTGCTTATGAAGCTCC
TAGAAGAGGCTGGTGGCAATTGGTCGTATATAAAGTTGGATAACTATACTGCACTGGTCGACGCTATTTATTCTGTTGAG
GATGAGAATAAGCAAAGTGAAGGTTCATCTAATGGTAATAGAGGGAAGAATCTTAAGGTCATTGACTCTCCTGCTACTCT
GAAAAAAACTTACGAAACCCGTTCTGCATCCTCAGGTTCCTCCATTCAGGTAGTCCAGAAGCAGCCACAGCTTAGTAATG
GTGATCGCAAGAGGAAATATAAAAGCAGAATTGCTGACATAACTAAAGGTTCAGAGAGCGTTAAAATCCCTCTTGTCGAT
GATGTTGGGAGTGAAGCTGTGCCAAAGTTTACTTACATCCCTCACAACATTGTTTACCAAAGTGCTTATCTCCACGTGTC
TCTGGCTCGAATCTCTGATGAAGATTGCTGCGCAAACTGCAAAGGGAACTGTCTTTCAGCTGACTTTCCTTGCACTTGTG
CTCGTGAAACCAGTGGAGAATATGCTTATACCAAAGAAGGGCTGCTAAAGGAAAAGTTTCTGGACACCTGTCTTAAGATG
AAAAAGGAACCAGATTCGTTCCCTAAAGTTTACTGCAAAGACTGCCCTTTGGAGAGAGATCACGATAAGGGCACATATGG
AAAATGTGATGGACACTTAATCCGAAAGTTCATCAAGGAATGCTGGAGAAAGTGTGGATGTGATATGCAGTGTGGAAATC
GAGTAGTACAGAGAGGGATAAGGTGCCAACTGCAGGTTTACTTTACTCAAGAAGGGAAAGGATGGGGTCTTAGAACACTG
CAAGACTTGCCCAAAGGAACCTTTATCTGTGAATACATTGGTGAAATATTGACCAACACGGAGTTATACGATCGGAATGT
TAGGTCTAGTAGTGAACGACATACATATCCTGTAACTCTGGATGCAGACTGGGGTTCTGAAAAGGATCTAAAAGATGAAG
AAGCTCTCTGCCTGGATGCCACAATCTGTGGAAATGTCGCAAGGTTTATCAATCACAGATGCGAGGATGCAAACATGATT
GATATTCCGATAGAGATAGAGACGCCTGACAGACATTATTATCATATTGCTTTTTTTACCCTACGAGACGTGAAGGCCAT
GGATGAGTTGACATGGGATTACATGATAGACTTCAATGATAAAAGTCATCCTGTAAAGGCATTTAGATGTTGCTGCGGAA
GCGAATCATGCAGAGACAGAAAAATAAAAGGATCTCAAGGCAAGTCTATAGAGAGAAGAAAGATTGTTTCTGCTAAAAAA
CAACAAGGTTCCAAAGAGGTGTCTAAAAAGCGCAAATGA