Details for Arabidopsis Locus AT3G04360

Position : Chr3 ( 5`- 1157004 .. 1158310 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G04360

Protein [Map View]
MGRLKFACPVLEINLISAQDLAPVSRNMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNEKFVFRVNDKILYVDASAIVI
EIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGNDGGGGNNNMRLVTLQIRRPSGRLQGFLRLGVALLDGGQRSMPLSIE
VFDGSRKGERNSVKRDQEASRMMHRRTNSDQTDLTTSTNDYGVKTGVVTGNGGGGGGGGGIVVGADSMVNGSLCSSDIGP
SASVVAAAIAQGLYNRQKTAVKAANKEDASSILEGKTEGIEHRVERWRAEKNGTGGAGGAAGSSDDSSGKGGAGRRRRRR
RRKEKQQGRRNGGGEGKKGLFSCFGNVFGCEISITCGGGSGGEGDSTKKRYNNNKVVNLSAVDETFSHSAT*

DNA
ATGGGTCGGCTCAAGTTCGCATGTCCGGTTCTTGAGATCAATTTAATCTCAGCTCAAGACTTAGCCCCTGTCTCAAGAAA
CATGAAAACGTATTCCGTCGCTTGGATCAACACCGATCCTATGAGAAAACTCACCACGCGTGTTGATCAATCCAACAGAG
CTAACCCTATATGGAACGAGAAGTTTGTGTTTCGTGTCAACGACAAGATTCTCTACGTTGACGCATCAGCGATTGTGATT
GAGATCTACGCAGCGGCTTGGGCTAAAGATGCTCTTGTTGGTACTGTGAATGTTCTTCTCAGCGATCTTTTTGCTCCTTG
GTCTGGTTTTGGTGATGGTAACGACGGTGGTGGTGGGAATAACAACATGAGGCTTGTGACTCTTCAGATTCGTCGTCCTT
CAGGGAGGCTACAAGGGTTTTTACGTCTCGGTGTTGCACTTCTTGACGGTGGTCAACGGAGTATGCCTTTATCTATTGAG
GTTTTCGATGGAAGTCGAAAAGGAGAGAGGAATAGTGTTAAAAGAGACCAAGAGGCTTCAAGAATGATGCATCGCCGTAC
GAATAGCGATCAAACGGATTTAACCACGTCTACGAATGATTACGGTGTGAAAACAGGGGTTGTTACTGGCAATGGAGGAG
GAGGTGGTGGTGGTGGCGGTATTGTTGTTGGTGCGGATAGTATGGTTAATGGTTCGCTTTGTAGCTCTGATATTGGACCA
TCAGCGTCTGTGGTTGCGGCTGCGATTGCGCAAGGGCTTTACAATAGACAGAAAACAGCGGTTAAAGCGGCTAACAAAGA
GGACGCAAGTTCGATACTTGAAGGGAAAACAGAGGGAATTGAGCATAGAGTTGAACGGTGGAGAGCAGAGAAAAATGGCA
CGGGTGGAGCGGGTGGAGCGGCTGGATCAAGCGATGATTCTAGCGGGAAAGGAGGAGCGGGAAGGAGAAGAAGGAGGAGG
AGAAGAAAGGAGAAACAACAAGGGAGGAGAAACGGTGGAGGAGAGGGTAAGAAAGGGTTGTTTTCATGTTTTGGAAACGT
GTTTGGATGTGAGATTTCGATAACATGTGGCGGTGGAAGCGGCGGAGAAGGAGACAGCACAAAGAAGAGATATAATAACA
ATAAAGTAGTAAATCTTAGTGCTGTAGACGAAACGTTTAGTCATTCTGCGACTTGA