Details for Arabidopsis Locus AT3G04340

Position : Chr3 ( 5`- 1146800 .. 1153341 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G04340

Protein [Map View]
MDFISASSLSSPFSTQLSPIYLSSGIVSLKPRHRVKNRNFGSRESNNKSRKIVPIRGCFGFSGSFLRSKQSDYGSEAVSE
SLRLCGEGNELVLSSEYNSAKTRESVIQFVTKPLVYALFCIAIGLSPIRSFQAPALAVPFVSDVIWKKKKERVREKEVVL
KAVDHEFSDYTRRLLETVSVLLKTIEIVRKENGEVAEVGAALDAVKVEKEKLQKEIMSGLYRDMRRLRKERDLLMKRADK
IVDEALSLKKQSEKLLRKGAREKMEKLEESVDIMESEYNKIWERIDEIDDIILKKETTTLSFGVRELIFIERECVELVKS
FNRELNQKSFESVPESSITKLSRSEIKQELVNAQRKHLEQMILPNVLELEEVDPFFDRDSVDFSLRIKKRLEESKKLQRD
LQNRIRKRMKKFGEEKLFVQKTPEGEAVKGFPEAEVKWMFGEKEVVVPKAIQLHLRHGWKKWQEEAKADLKQKLLEDVDF
GKQYIAQRQEQVLLDRDRVVSKTWYNEDKSRWEMDPMAVPYAVSRKLIDSARIRHDYAVMYVALKGDDKEFYVDIKEYEM
LFEKFGGFDALYLKMLACGIPTSVHLMWIPMSELSLQQQFLLVTRVVSRVFNALRKTQVVSNAKDTVLEKIRNINDDIMM
AVVFPVIEFIIPYQLRLRLGMAWPEEIEQTVGSTWYLQWQSEAEMNFKSRNTEDFQWFLWFLIRSSIYGFVLYHVFRFLK
RKVPRLLGYGPFRRDPNVRKFWRVKSYFTYRKRRIKQKRKAGIDPIKTAFDRMKRVKNPPIPLKNFASIESMREEINEVV
AFLQNPKAFQEMGARAPRGVLIVGERGTGKTSLALAIAAEARVPVVNVEAQELEAGLWVGQSAANVRELFQTARDLAPVI
IFVEDFDLFAGVRGKFVHTKQQDHESFINQLLVELDGFEKQDGVVLMATTRNHKQIDEALRRPGRMDRVFHLQSPTEMER
ERILHNAAEETMDRELVDLVDWRKVSEKTTLLRPIELKLVPMALESSAFRSKFLDTDELLSYVSWFATFSHIVPPWLRKT
KVAKTMGKMLVNHLGLNLTKDDLENVVDLMEPYGQISNGIELLNPTVDWTRETKFPHAVWAAGRALITLLIPNFDVVENL
WLEPSSWEGIGCTKITKVTSGGSAIGNTESRSYLEKKLVFCFGSHIASQMLLPPGDENFLSSSEITKAQEIATRMVLQYG
WGPDDSPAVYYATNAVSALSMGNNHEYEMAGKVEKIYDLAYEKAKGMLLKNRRVLEKITEELLEFEILTHKDLERIVHEN
GGIREKEPFFLSGTNYNEALSRSFLDVGDPPETALLSAPT*

DNA
ATGGATTTCATTTCCGCTTCTTCCTTATCTTCACCCTTTTCCACACAGTTGTCTCCGATTTATTTGAGCTCAGGTATAGT
ATCGTTAAAGCCTAGACATCGAGTCAAAAATCGAAACTTTGGGTCTAGAGAATCCAATAATAAATCTAGGAAAATTGTGC
CCATTAGAGGCTGCTTTGGTTTTTCCGGGAGTTTTTTGAGGTCGAAACAGTCTGATTACGGTAGTGAAGCTGTTTCGGAA
TCATTGAGATTATGTGGAGAGGGAAATGAGCTTGTGCTATCTTCCGAGTATAATAGCGCAAAGACGAGAGAGAGCGTAAT
ACAGTTTGTTACCAAGCCTCTAGTTTACGCCTTGTTTTGTATTGCAATTGGACTTTCTCCGATTCGCTCTTTTCAAGCTC
CAGCTTTAGCTGTGCCTTTCGTCAGTGATGTTATTTGGAAGAAAAAGAAAGAGAGAGTGAGAGAGAAAGAGGTGGTTTTG
AAAGCAGTTGATCATGAGTTCTCGGATTATACTCGGAGATTGTTGGAGACAGTCTCGGTTTTACTGAAGACTATTGAGAT
AGTTAGAAAGGAAAATGGAGAGGTTGCTGAAGTGGGAGCGGCTTTGGATGCAGTTAAGGTGGAGAAGGAGAAACTGCAGA
AGGAGATAATGAGTGGGTTATATCGTGATATGAGGCGGTTGAGGAAGGAGAGAGATTTGTTAATGAAACGAGCTGATAAA
ATTGTAGATGAGGCCCTAAGTTTGAAGAAACAGAGTGAAAAACTGTTGAGAAAAGGTGCTAGGGAGAAAATGGAGAAACT
GGAAGAGAGTGTGGATATTATGGAGAGCGAGTACAATAAGATATGGGAAAGAATAGATGAGATTGATGATATCATTTTAA
AGAAAGAGACAACAACATTGAGTTTTGGGGTTAGGGAGCTTATTTTCATTGAAAGAGAGTGTGTAGAGTTGGTTAAGAGC
TTCAACCGAGAATTGAATCAAAAAAGTTTTGAAAGTGTTCCTGAAAGCTCCATTACAAAACTCTCGAGGTCTGAGATTAA
GCAGGAATTAGTGAACGCTCAAAGAAAGCACTTGGAACAAATGATACTGCCCAATGTTTTGGAACTAGAGGAGGTTGATC
CCTTTTTCGATCGTGACTCAGTGGATTTTTCTCTACGCATCAAAAAACGCCTTGAGGAATCAAAAAAGCTGCAGAGAGAT
CTTCAGAATCGTATCAGAAAACGTATGAAAAAGTTTGGTGAAGAAAAGCTTTTTGTTCAAAAGACTCCAGAAGGTGAAGC
TGTCAAGGGATTTCCTGAAGCAGAGGTGAAATGGATGTTTGGAGAGAAAGAGGTGGTTGTTCCGAAAGCTATCCAGCTCC
ATCTACGCCATGGTTGGAAAAAGTGGCAGGAAGAAGCAAAAGCCGATTTAAAACAGAAACTTTTGGAAGATGTTGATTTT
GGCAAACAATATATTGCGCAGAGACAGGAACAAGTTCTCCTGGATCGAGATAGAGTTGTTTCGAAGACTTGGTATAACGA
AGACAAAAGTAGGTGGGAGATGGACCCTATGGCTGTTCCCTACGCAGTTTCCAGGAAGCTGATTGACAGTGCCAGGATTA
GGCATGATTATGCTGTAATGTATGTTGCATTAAAAGGAGATGACAAGGAGTTTTACGTTGATATCAAGGAATATGAGATG
CTATTTGAGAAATTTGGAGGGTTTGATGCTCTGTACCTCAAAATGCTTGCTTGTGGAATCCCAACTTCTGTTCATCTGAT
GTGGATACCCATGTCAGAGCTAAGTCTTCAACAACAGTTTCTGTTGGTTACAAGGGTGGTTTCTCGAGTCTTTAACGCAT
TGAGGAAGACTCAAGTTGTATCAAATGCGAAGGATACAGTATTAGAGAAAATAAGGAATATAAACGATGACATTATGATG
GCGGTTGTGTTTCCAGTTATCGAATTTATCATTCCTTACCAGTTAAGGCTGCGTCTGGGAATGGCTTGGCCAGAAGAAAT
AGAACAGACTGTTGGCTCAACATGGTACTTACAATGGCAGTCTGAAGCAGAAATGAATTTCAAGTCCCGCAATACAGAAG
ATTTTCAGTGGTTCCTCTGGTTTCTAATTCGAAGTTCTATATACGGGTTTGTTTTGTATCACGTTTTCCGCTTTCTAAAA
AGAAAGGTTCCAAGACTTCTTGGCTATGGACCCTTCCGCCGAGATCCCAACGTACGGAAATTCTGGAGAGTGAAATCATA
TTTCACTTATAGAAAAAGGAGAATCAAACAAAAGAGAAAGGCTGGAATCGACCCCATAAAAACTGCATTCGACAGAATGA
AGAGAGTGAAAAATCCACCTATCCCATTAAAGAACTTTGCTAGTATTGAGTCTATGAGAGAAGAAATCAACGAGGTTGTG
GCATTTTTACAGAATCCAAAGGCATTTCAGGAGATGGGAGCCCGCGCACCTCGGGGCGTTCTTATTGTGGGTGAGAGAGG
AACGGGAAAGACGTCACTGGCGCTCGCTATAGCAGCCGAAGCAAGAGTGCCTGTTGTCAATGTTGAAGCTCAAGAGTTGG
AAGCTGGGCTATGGGTTGGTCAAAGTGCAGCGAATGTCAGGGAACTCTTTCAAACTGCAAGAGACTTGGCACCTGTAATC
ATTTTTGTGGAGGATTTTGACCTCTTTGCTGGTGTACGCGGGAAGTTTGTACATACAAAACAGCAAGATCATGAATCGTT
CATTAATCAGCTTCTTGTTGAACTTGATGGCTTTGAGAAACAGGATGGCGTAGTTTTGATGGCGACGACACGAAATCATA
AGCAAATTGATGAGGCGCTAAGAAGGCCAGGTCGTATGGATAGAGTATTCCATCTTCAAAGTCCAACTGAAATGGAAAGG
GAGAGGATTTTACACAACGCTGCAGAAGAAACCATGGACCGAGAACTCGTTGATCTAGTGGATTGGCGTAAGGTTTCAGA
GAAGACAACTTTATTAAGACCGATAGAACTGAAACTTGTTCCAATGGCTCTCGAAAGTAGTGCCTTCAGAAGCAAATTTC
TGGACACTGACGAACTTCTGAGTTACGTTAGCTGGTTTGCGACGTTTAGCCATATAGTGCCCCCATGGCTGCGAAAAACT
AAAGTTGCAAAGACAATGGGCAAAATGCTTGTGAATCATCTTGGACTTAACTTAACCAAAGATGATTTGGAGAATGTGGT
TGATCTGATGGAACCATATGGACAAATAAGTAATGGAATAGAACTTTTGAATCCTACTGTTGATTGGACGAGGGAGACAA
AGTTCCCACATGCTGTCTGGGCGGCTGGTCGTGCTCTCATCACACTTCTAATACCAAACTTTGATGTTGTGGAAAATCTT
TGGCTTGAGCCTAGTTCCTGGGAAGGAATTGGGTGTACAAAAATCACCAAGGTCACAAGTGGAGGCTCCGCGATTGGGAA
CACGGAATCAAGATCATATCTTGAAAAGAAGCTCGTTTTCTGCTTTGGATCTCACATTGCATCCCAAATGCTTCTTCCTC
CCGGAGATGAAAATTTTCTTTCTTCTTCAGAAATAACTAAAGCGCAGGAGATTGCAACACGTATGGTGCTTCAATATGGC
TGGGGACCCGATGACAGTCCTGCAGTATACTATGCTACTAACGCGGTTTCAGCTTTGAGTATGGGGAACAATCACGAATA
TGAAATGGCGGGTAAAGTTGAAAAGATTTATGACTTAGCGTACGAAAAGGCAAAGGGAATGCTCCTTAAAAATCGACGTG
TCCTTGAGAAAATCACAGAGGAGCTACTCGAATTTGAGATTTTAACTCATAAGGATTTGGAAAGAATTGTTCATGAGAAT
GGTGGGATTCGGGAGAAGGAACCTTTCTTTCTATCAGGAACCAATTACAATGAGGCATTGTCAAGGAGTTTTCTTGATGT
TGGAGATCCGCCAGAAACTGCACTTCTTAGTGCACCAACCTAA