Details for Arabidopsis Locus AT3G04310

Position : Chr3 ( 5`- 1141581 .. 1142528 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G04310

Protein [Map View]
MANLLYLQLSSCVVRGRFCSLNCDFDLCPNIVSRGSFDCRASRGPSWEEELFRDEGFASFEFGNRKKKRPWWLDDDDDDD
DNDDWMNEEEEDWSMVFEVFRTLSWMLAPIGISLLLGTDSNAGVMALAVPLVQSVLSLVVSKVWSRPSIRSMKRSRRDTF
SRSASVSSGRTRKARQGGNMRGGVDKGGYKSWIVGDDDSNSMGTGYGGWDDLDTLREIRNDNPLNENVRPKQQFERKATR
RWRVKEKPLLLRMLIAAFPFLGSWTKLLF*

DNA
ATGGCGAATCTGCTGTATCTTCAGCTTTCTTCTTGCGTCGTCAGAGGCAGATTCTGTTCTCTAAACTGCGATTTTGATCT
CTGCCCAAATATCGTGAGCCGCGGTTCCTTTGATTGCCGCGCCTCCCGCGGTCCTAGCTGGGAGGAGGAGCTCTTCCGCG
ACGAAGGTTTTGCTTCGTTTGAGTTCGGAAACCGTAAAAAGAAGAGGCCTTGGTGGCTTGATGATGATGATGACGATGAC
GACAACGATGATTGGATGAATGAAGAAGAAGAAGACTGGTCTATGGTTTTTGAGGTATTTAGAACATTGAGTTGGATGCT
TGCACCAATTGGCATATCTTTGCTTCTTGGAACAGATTCAAACGCGGGTGTAATGGCATTAGCAGTTCCTTTAGTGCAAT
CTGTGTTGTCTCTTGTGGTTAGTAAAGTTTGGAGCAGGCCAAGCATTAGGTCTATGAAAAGAAGTAGAAGAGATACATTT
TCGAGATCTGCGAGTGTAAGTAGTGGAAGAACAAGGAAAGCTAGGCAAGGAGGAAACATGAGGGGTGGTGTAGATAAGGG
AGGATACAAGTCATGGATAGTAGGAGATGATGATTCTAACAGCATGGGTACTGGCTATGGAGGATGGGATGATCTAGATA
CGCTAAGGGAGATTAGAAATGACAATCCATTAAACGAGAATGTTCGTCCAAAACAACAGTTTGAAAGAAAGGCTACTCGG
CGGTGGAGAGTTAAGGAGAAGCCATTGCTCTTGAGGATGCTAATTGCTGCCTTCCCTTTTTTGGGTTCATGGACCAAATT
GTTGTTTTGA