Details for Arabidopsis Locus AT3G04300

Position : Chr3 ( 5`- 1140193 .. 1141030 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G04300

Protein [Map View]
MNIVIENNPSSRRLSDLGVMSWPKWSCQPGKYALVFEERETCYLVKGKVKVYPKGSSEFVEFGAGDLVTIPKGLSCTWDV
SLFIDKHYKFDPPTSP*

DNA
ATGAATATTGTAATCGAAAACAACCCTTCGAGCAGAAGGTTATCTGACCTTGGAGTCATGTCATGGCCTAAATGGTCTTG
TCAGCCGGGGAAATATGCATTGGTATTTGAAGAAAGAGAGACATGCTATTTGGTGAAGGGAAAGGTGAAGGTGTATCCAA
AAGGGTCATCTGAGTTTGTAGAGTTTGGTGCAGGAGACCTTGTGACCATCCCCAAGGGACTTAGCTGCACTTGGGATGTA
TCACTTTTCATAGACAAACACTACAAGTTCGATCCTCCTACTTCTCCATAA