Details for Arabidopsis Locus AT3G04260

Position : Chr3 ( 5`- 1123023 .. 1127515 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G04260

Protein [Map View]
MSLLFLNPPFPSNSIHPIPRRAAGISSIRCSISAPEKKPRRRRKQKRGDGAENDDSLSFGSGEAVSALERSLRLTFMDEL
MERARNRDTSGVSEVIYDMIAAGLSPGPRSFHGLVVAHALNGDEQGAMHSLRKELGAGQRPLPETMIALVRLSGSKGNAT
RGLEILAAMEKLKYDIRQAWLILVEELMRINHLEDANKVFLKGARGGMRATDQLYDLMIEEDCKAGDHSNALDISYEMEA
AGRMATTFHFNCLLSVQATCGIPEVAYATFENMEYGEVFMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHKRV
QPNVKTYALLVECFTKYCVVKEAIRHFRALKNFEGGTVILHNAGNFEDPLSLYLRALCREGRIVELIDALDAMRKDNQPI
PPRAMIMSRKYRTLVSSWIEPLQEEAELGYEIDYLARYIEEGGLTGERKRWVPRRGKTPLDPDASGFIYSNPIETSFKQR
CLEDWKVHHRKLLRTLQSEGLPVLGDASESDYMRVVERLRNIIKGPALNLLKPKAASKMVVSELKEELEAQGLPIDGTRN
VLYQRVQKARRINKSRGRPLWVPPIEEEEEEVDEEVDDLICRIKLHEGDTEFWKRRFLGEGLIETSVESKETTESVVTGE
SEKAIEDISKEADNEEDDDEEEQEGDEDDDENEEEEVVVPETENRAEGEDLVKNKAADAKKHLQMIGVQLLKESDEANRT
KKRGKRASRMTLEDDADEDWFPEEPFEAFKEMRERKVFDVADMYTIADVWGWTWEKDFKNKTPRKWSQEWEVELAIVLMT
KVIELGGIPTIGDCAVILRAALRAPMPSAFLKILQTTHSLGYSFGSPLYDEIITLCLDLGELDAAIAIVADMETTGITVP
DQTLDKVISARQSNESPRSEPEEPASTVSS*

DNA
ATGTCACTCTTGTTCCTCAATCCTCCGTTTCCCTCCAATTCAATCCACCCAATTCCTCGTCGTGCCGCCGGAATATCCTC
CATTCGATGCTCAATTTCTGCACCGGAGAAGAAACCGAGGAGGAGGAGGAAGCAGAAGCGCGGCGACGGAGCTGAGAATG
ACGACTCTTTGTCTTTCGGAAGTGGTGAAGCTGTCTCCGCTCTGGAGAGGAGTCTCCGCCTCACTTTTATGGACGAGCTT
ATGGAACGAGCTAGAAATCGAGATACTTCAGGTGTTTCTGAGGTTATCTATGACATGATTGCTGCTGGGCTTAGCCCTGG
ACCTCGTTCTTTCCATGGTTTGGTTGTAGCTCACGCGCTTAACGGCGACGAACAAGGCGCGATGCACTCGCTGAGAAAGG
AGCTAGGTGCAGGCCAACGTCCGCTTCCTGAGACTATGATTGCTTTGGTTCGTCTCTCTGGTTCGAAAGGGAATGCTACG
AGAGGCCTAGAAATCCTCGCCGCTATGGAAAAGCTTAAGTATGACATTCGTCAAGCTTGGCTCATTCTTGTTGAGGAGCT
CATGAGGATCAATCACTTGGAAGATGCGAATAAAGTTTTCTTGAAGGGTGCAAGAGGTGGGATGAGAGCAACAGATCAGC
TTTATGATTTGATGATTGAAGAAGATTGCAAAGCTGGAGATCATTCTAATGCCTTAGACATCTCTTACGAAATGGAGGCA
GCTGGTAGAATGGCCACAACATTTCATTTCAACTGTCTTCTTAGTGTGCAGGCTACATGTGGGATTCCCGAGGTAGCTTA
TGCTACATTCGAAAATATGGAGTACGGTGAAGTATTTATGAAGCCTGACACTGAGACATATAACTGGGTGATTCAAGCCT
ACACTAGAGCCGAGTCATATGATAGGGTTCAGGATGTTGCTGAATTACTTGGAATGATGGTTGAGGACCACAAACGTGTG
CAGCCAAATGTGAAGACTTATGCGCTCTTAGTTGAGTGCTTCACCAAATATTGTGTCGTGAAGGAAGCGATTAGACATTT
TCGTGCTCTTAAAAACTTTGAAGGAGGAACAGTAATTTTACACAATGCAGGGAATTTTGAGGATCCTCTCTCTTTGTATC
TCAGGGCTTTGTGTCGAGAAGGAAGAATTGTTGAGCTTATTGATGCTTTAGATGCAATGCGCAAAGATAACCAACCTATA
CCTCCAAGAGCCATGATTATGAGCAGAAAGTATCGAACACTAGTCAGCTCATGGATTGAACCATTGCAAGAAGAAGCTGA
ACTTGGCTATGAGATTGATTATTTAGCGAGGTACATAGAGGAAGGGGGACTTACTGGTGAACGCAAGCGTTGGGTACCTC
GAAGAGGGAAAACTCCTTTAGATCCCGATGCTTCTGGTTTTATATACTCAAACCCTATTGAAACATCCTTTAAACAGAGA
TGCCTTGAAGATTGGAAAGTTCACCATAGGAAGCTCTTGAGAACCTTACAGAGTGAAGGTCTTCCAGTTCTAGGAGATGC
ATCAGAATCTGATTACATGAGAGTGGTGGAGAGATTACGGAACATAATAAAAGGTCCTGCACTGAATCTTTTGAAGCCGA
AAGCAGCAAGCAAGATGGTTGTATCAGAGTTAAAGGAAGAACTCGAAGCTCAGGGTTTGCCAATTGATGGAACAAGAAAT
GTGCTTTACCAGCGTGTCCAAAAAGCAAGGAGAATAAACAAATCTCGAGGTCGACCTCTTTGGGTTCCTCCAATTGAAGA
AGAAGAGGAGGAGGTCGATGAAGAAGTAGACGATTTAATATGTCGAATCAAGCTACATGAAGGAGACACAGAGTTCTGGA
AACGTCGGTTTCTTGGAGAAGGCTTGATTGAAACTTCAGTTGAATCCAAGGAAACGACTGAATCAGTGGTTACAGGTGAA
TCGGAGAAAGCGATTGAAGATATTTCAAAAGAAGCTGACAATGAGGAGGATGATGATGAGGAGGAACAAGAAGGAGATGA
GGATGATGATGAAAATGAAGAGGAAGAAGTGGTTGTTCCAGAAACTGAGAATCGAGCAGAAGGAGAAGATTTAGTGAAGA
ATAAGGCAGCTGACGCGAAGAAGCATCTTCAAATGATTGGAGTCCAACTCTTGAAAGAATCCGATGAAGCAAACAGAACA
AAGAAACGTGGGAAGAGGGCATCTCGTATGACACTTGAGGATGATGCAGATGAGGATTGGTTCCCTGAGGAACCATTTGA
AGCATTCAAAGAAATGAGGGAAAGAAAAGTGTTCGATGTGGCTGACATGTATACAATAGCAGACGTTTGGGGTTGGACAT
GGGAGAAGGATTTTAAGAACAAAACTCCAAGGAAATGGTCACAAGAGTGGGAAGTCGAGTTGGCAATTGTGCTCATGACA
AAGGTGATTGAATTGGGTGGAATTCCAACGATTGGTGATTGTGCAGTGATATTACGAGCTGCTTTAAGAGCTCCCATGCC
TTCAGCCTTCTTGAAGATCTTGCAGACGACACACAGTCTTGGCTACTCATTTGGCAGCCCGTTGTACGATGAGATCATCA
CATTGTGTTTGGACCTTGGAGAACTTGATGCAGCCATCGCCATAGTTGCAGATATGGAAACCACAGGGATCACTGTCCCT
GATCAAACCCTTGACAAGGTCATATCTGCTAGACAATCTAATGAGAGTCCGCGGTCTGAGCCTGAAGAGCCAGCATCAAC
AGTAAGCTCTTAG