Details for Arabidopsis Locus AT3G04240

Position : Chr3 ( 5`- 1113934 .. 1120872 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G04240

Protein [Map View]
MISSKNGAAMISRPVFLSDRVDEVFSRKLDLSVSSSSSSSLLQQFNKTHEGDDDARLALAHQLYKGGDFKQALEHSNMVY
QRNPLRTDNLLLIGAIYYQLQEYDMCIARNEEALRIQPQFAECYGNMANAWKEKGDTDRAIRYYLIAIELRPNFADAWSN
LASAYMRKGRLSEATQCCQQALSLNPLLVDAHSNLGNLMKAQGLIHEAYSCYLEAVRIQPTFAIAWSNLAGLFMESGDLN
RALQYYKEAVKLKPAFPDAYLNLGNVYKALGRPTEAIMCYQHALQMRPNSAMAFGNIASIYYEQGQLDLAIRHYKQALSR
DPRFLEAYNNLGNALKDIGRVDEAVRCYNQCLALQPNHPQAMANLGNIYMEWNMMGPASSLFKATLAVTTGLSAPFNNLA
IIYKQQGNYSDAISCYNEVLRIDPLAADALVNRGNTYKEIGRVTEAIQDYMHAINFRPTMAEAHANLASAYKDSGHVEAA
ITSYKQALLLRPDFPEATCNLLHTLQCVCCWEDRSKMFAEVESIIRRQINMSVLPSVQPFHAIAYPIDPILALEISRKYA
AHCSIIASRFGLPPFTHPAGLPVKREGGFKRLRIGYVSSDFGNHPLSHLMGSVFGMHNRENVEVFCYALSANDNTEWRQR
IQSEAEHFLDVSAMSSDAIAKIINQDKIQILINLNGYTKGARNEIFAMQPAPIQVSYMGFPGTTGATYIDYLVTDEFVSP
LQYAHIYSEKLVHLPHCYFVNDYKQKNQDVLDPNSKPKRSDYGLPEDKFIFACFNQLYKMDPEIVNTWCNILKRVPNSAL
WLLRFPAAGEMRFRTYAAAQGVQPDQIIFTDVAMKSEHIRRSVLADVILDTPLCNGHTTGTDVLWAGVPMITLPLEKMAT
RVAGSLCLATGLGHGMIVNSLEEYEEKAVSLALNKPKLQALTKELRASRLTCPLFDTMRWVKNLERSYFKMWNLHCSGQQ
PQHFKVLENDLEFPHDR*

DNA
ATGATCTCGTCCAAAAACGGAGCTGCCATGATCTCCCGACCTGTCTTTCTTTCCGATCGAGTTGATGAAGTCTTCTCTAG
AAAGCTTGATTTGTCTGTCTCTTCTTCGTCTTCTTCGAGCCTCCTCCAGCAGTTCAATAAGACTCATGAAGGTGATGATG
ACGCACGCCTGGCTCTTGCTCATCAGCTATACAAAGGAGGCGATTTCAAACAAGCCCTGGAGCACAGCAACATGGTTTAC
CAGAGAAACCCATTACGCACTGATAATCTTCTTCTAATTGGTGCTATTTATTACCAGCTTCAAGAGTATGATATGTGCAT
AGCTCGAAATGAAGAAGCTCTTCGTATTCAACCTCAGTTTGCTGAGTGTTATGGAAACATGGCAAACGCGTGGAAGGAAA
AAGGGGACACTGATCGTGCAATCCGCTACTATTTAATTGCAATTGAGCTGAGGCCCAATTTTGCTGATGCTTGGTCGAAC
TTGGCAAGTGCATACATGCGAAAGGGAAGACTCAGTGAGGCAACACAATGCTGTCAGCAGGCCCTCTCATTGAATCCACT
TCTGGTTGACGCACATAGTAATCTGGGGAATCTGATGAAGGCTCAAGGATTGATTCATGAAGCATACAGTTGTTACCTTG
AAGCTGTTCGTATACAACCAACATTTGCTATTGCATGGTCGAATCTTGCTGGTCTTTTCATGGAGTCAGGTGATCTCAAC
AGAGCCCTTCAATACTACAAGGAAGCTGTGAAGTTGAAACCTGCATTCCCTGATGCATATTTAAATTTAGGAAACGTGTA
TAAGGCCCTCGGGAGACCTACTGAAGCGATCATGTGTTATCAGCATGCCTTACAGATGCGGCCAAATTCTGCAATGGCAT
TTGGGAATATAGCCAGTATATACTATGAGCAAGGTCAACTAGATTTAGCAATTCGACACTACAAGCAGGCTCTCTCCCGG
GATCCACGATTTTTGGAGGCTTACAATAACTTGGGTAATGCATTGAAGGATATTGGGCGAGTTGATGAAGCAGTTCGGTG
TTATAATCAATGTCTTGCTTTACAACCAAATCATCCACAAGCCATGGCTAATCTTGGAAACATTTATATGGAGTGGAATA
TGATGGGTCCTGCTTCCTCATTATTCAAGGCTACTCTGGCTGTAACTACAGGGCTATCTGCTCCGTTCAATAACCTTGCT
ATAATTTACAAGCAACAGGGAAATTACTCGGATGCTATATCCTGCTATAATGAGGTTCTTCGTATTGACCCATTGGCAGC
TGACGCTCTGGTTAATAGAGGGAATACTTACAAAGAGATCGGGAGGGTAACTGAAGCAATTCAGGATTACATGCATGCTA
TAAACTTCCGGCCTACAATGGCTGAAGCTCACGCAAACCTGGCCTCAGCTTACAAGGATAGTGGGCATGTAGAAGCTGCC
ATTACGAGCTATAAGCAGGCCTTGCTTCTACGACCAGACTTCCCAGAAGCAACGTGCAACCTTCTACACACCTTACAGTG
TGTATGCTGTTGGGAGGACCGTAGCAAAATGTTCGCTGAAGTTGAAAGCATTATTAGGAGGCAAATAAATATGTCGGTCC
TTCCAAGTGTCCAGCCCTTCCATGCAATAGCATATCCTATTGACCCTATTCTTGCCCTTGAAATCAGTCGTAAATACGCT
GCACACTGCTCCATAATCGCTTCTCGTTTTGGACTACCTCCTTTTACCCATCCAGCTGGGCTCCCTGTAAAACGTGAGGG
AGGATTTAAGAGATTAAGGATTGGATACGTGAGCAGTGATTTTGGTAACCATCCGTTGTCACACCTCATGGGATCAGTGT
TTGGGATGCACAACAGAGAAAACGTTGAGGTTTTCTGCTATGCTCTGAGTGCAAATGATAATACTGAGTGGAGACAGCGA
ATCCAGTCAGAAGCCGAGCATTTCCTGGACGTTTCTGCTATGTCATCTGATGCTATCGCCAAAATTATAAACCAAGACAA
AATCCAGATCCTCATCAATCTAAACGGTTATACCAAGGGGGCTAGAAATGAAATATTTGCCATGCAGCCTGCTCCGATCC
AGGTTTCATATATGGGCTTCCCGGGTACCACTGGAGCAACCTATATTGACTATCTAGTGACTGATGAGTTCGTGTCTCCT
CTGCAATATGCACATATTTACTCAGAGAAGCTGGTCCACCTTCCCCATTGCTACTTTGTCAATGATTACAAGCAGAAAAA
TCAGGATGTGTTGGATCCAAATTCGAAGCCCAAGCGATCAGACTATGGACTTCCTGAAGACAAATTCATATTTGCATGCT
TCAACCAACTGTACAAAATGGATCCTGAGATCGTTAATACTTGGTGCAACATTCTTAAACGAGTACCCAACAGTGCTCTT
TGGCTTCTCCGTTTTCCAGCAGCCGGAGAGATGAGGTTTCGCACATATGCTGCTGCCCAAGGTGTACAGCCTGATCAAAT
TATCTTCACTGATGTTGCCATGAAGAGTGAACATATCAGGCGAAGTGTCCTTGCCGATGTAATCCTCGACACGCCCCTGT
GCAATGGACACACAACAGGAACAGATGTACTGTGGGCTGGTGTACCAATGATAACGTTACCACTTGAGAAAATGGCAACT
CGAGTGGCTGGATCACTCTGCCTTGCAACTGGTCTGGGCCATGGGATGATTGTTAACAGCTTGGAGGAGTACGAAGAGAA
GGCTGTCTCTTTGGCACTGAACAAGCCAAAACTTCAGGCACTGACTAAGGAATTGAGGGCTAGCCGCTTAACCTGTCCTC
TATTCGACACCATGCGTTGGGTGAAGAATCTGGAGAGGTCATACTTCAAAATGTGGAACCTCCATTGCTCTGGGCAGCAG
CCACAACACTTCAAGGTGTTGGAAAACGACCTAGAATTCCCACATGACAGATAA