Details for Arabidopsis Locus AT3G04230

Position : Chr3 ( 5`- 1112990 .. 1113659 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G04230

Protein [Map View]
MATQPAKESVQCFGRKKTATAVTYCKRGSGMIKLNGSPIELYQPEILRFKIFEPVLLLGKHRFAGVDMRIRATGGGNTSR
VYAIRQSIAKALVAYYQKYVDEQSKKEIKDILMRYDRTLLVADPRRCESKKFGGPGARARFQKSYR*

DNA
ATGGCGACCCAACCGGCGAAAGAGTCTGTTCAATGTTTCGGAAGGAAGAAGACGGCAACAGCAGTCACCTACTGCAAACG
GGGCTCGGGCATGATTAAGCTCAACGGTTCGCCGATCGAGCTTTATCAGCCAGAGATCCTCCGATTCAAGATCTTCGAGC
CAGTCCTTCTCCTCGGGAAACACCGTTTCGCCGGAGTTGACATGAGGATCCGTGCCACGGGCGGTGGTAACACATCTCGG
GTCTACGCAATCCGTCAGAGTATCGCTAAGGCCCTCGTTGCTTACTACCAGAAGTACGTTGATGAGCAGTCGAAGAAGGA
GATCAAGGACATCTTGATGAGGTACGATAGGACTCTTCTTGTTGCGGATCCGAGAAGGTGCGAGTCGAAGAAGTTTGGTG
GTCCTGGTGCTCGTGCTCGTTTCCAGAAGAGTTACCGTTAG