Details for Arabidopsis Locus AT3G04160

Position : Chr3 ( 5`- 1091147 .. 1094346 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G04160

Protein [Map View]
MDRPPSLPHYQNPNPNLFYHYPPPNSNPNFFFRPPPPPLQNPNNYSIVPSPPPIRELSGTLSSLKSLLSECQRTLDSLSQ
NLALDHSSLLQKDENGCFVRCPFDSNHFMPPEALFLHSLRCPNTLDLIHLLESFSSYRNTLELPCELQLNNGDGDLCISL
DDLADFGSNFFYRDCPGAVKFSELDGKKRTLTLPHVLSVECSDFVGSDEKVKKIVLDKCLGVLPSDLCAMKNEIDQWRDF
PSSYSSSVLSSIVGSKVVEISALRKWILVNSTRYGVIIDTFMRDHIFLLFRLCLKSAVKEACGFRMESDATDVGEQKIMS
CKSSTFECPVFIQVLSWLASQLAVLYGEGNGKFFALDMFKQCIVESASQVMLFRLEGTRSKCSGVVEDLDDARLRNKDVI
MEKPFENSSGGECGKTLDSPQVISVSRVSAAVAALYERSLLEEKIRAVRYAQPLTRYQRIISCLHLSLIPHDVSERNRRC
SYRPIIDHDGRPRQRSLNQDMDKMKTREELLAEERDYKRRRMSYRGKKVKRTPRQVLHDMIEEYTEEIKLAGGIGCFEKG
MPLQSRSPIGNDQKESDFGYSIPSTDKQWKGENRADIEYPIDNRQNSDKVKRHDEYDSGSSQRQQSHRSYKHSDRRDDKL
RDRRKDKHNDRRDDEFTRTKRHSIEGESYQNYRSSREKSSSDYKTKRDDPYDRRSQQPRNQNLFEDRYIPTEKE*

DNA
ATGGATCGACCACCGTCGTTGCCACACTATCAAAACCCTAATCCGAACCTCTTCTACCACTATCCTCCTCCAAATTCTAA
TCCTAATTTCTTCTTCCGACCTCCTCCACCTCCTCTTCAAAATCCTAACAATTACTCCATCGTTCCGTCTCCGCCGCCGA
TTCGCGAGCTCTCCGGTACACTCTCTTCTTTAAAATCCCTGTTGTCAGAATGTCAAAGAACCTTAGATTCTCTCTCGCAA
AATCTAGCTTTAGATCACTCTTCTCTTCTCCAGAAGGACGAAAATGGCTGTTTTGTTCGTTGCCCTTTTGATTCAAATCA
CTTTATGCCACCTGAAGCTCTCTTTCTTCATTCACTTCGTTGCCCAAATACTCTTGACCTCATTCATCTTCTTGAATCCT
TTAGTAGTTACCGGAACACGCTCGAGTTACCATGTGAACTACAGTTGAACAACGGTGATGGTGATCTCTGTATCTCTTTA
GATGACTTGGCCGATTTTGGGAGCAATTTCTTCTACCGAGATTGTCCAGGAGCTGTTAAATTCTCTGAGCTCGATGGAAA
AAAACGAACTTTAACACTTCCTCATGTTCTATCTGTGGAATGTAGCGATTTTGTAGGTTCTGATGAGAAGGTGAAAAAGA
TTGTCTTGGATAAATGCTTAGGAGTCTTACCGTCTGATCTTTGTGCAATGAAGAATGAGATTGATCAATGGAGGGATTTC
CCAAGTTCGTATTCCTCTAGTGTTCTTTCTTCGATTGTGGGTTCAAAAGTGGTTGAAATAAGTGCATTGAGGAAATGGAT
TCTGGTTAATTCGACGAGATATGGTGTTATAATTGATACATTCATGAGGGATCATATATTCTTACTCTTTCGGTTGTGTC
TCAAATCTGCTGTGAAAGAAGCTTGTGGATTTAGGATGGAGTCTGATGCTACTGATGTTGGTGAGCAGAAGATTATGAGC
TGCAAGAGTAGTACATTTGAGTGTCCAGTCTTCATTCAAGTCTTGTCTTGGTTAGCTTCTCAACTTGCTGTCTTGTATGG
AGAAGGAAATGGGAAGTTTTTTGCTTTGGACATGTTTAAACAGTGCATAGTAGAATCTGCCTCTCAGGTAATGTTGTTCC
GGTTAGAAGGAACTAGATCTAAATGCTCTGGAGTTGTCGAGGATTTGGATGATGCAAGGTTGAGAAATAAGGATGTGATC
ATGGAGAAGCCCTTTGAGAATAGTTCAGGTGGGGAATGTGGCAAAACTTTGGACAGTCCACAGGTGATATCTGTGTCCCG
TGTTTCAGCAGCTGTTGCAGCTTTGTATGAAAGATCCTTGCTTGAAGAAAAAATAAGGGCAGTTCGATATGCCCAACCAC
TAACGAGATATCAGCGCATCATTTCATGTTTGCATTTGAGTTTGATTCCTCATGATGTCTCTGAACGGAATAGACGTTGT
AGCTACCGACCTATTATTGATCATGATGGTCGTCCGAGACAACGCTCATTAAATCAGGATATGGATAAAATGAAGACAAG
GGAAGAGCTTTTAGCTGAAGAGAGAGATTATAAGCGTCGTCGAATGTCATACCGTGGAAAGAAGGTGAAACGAACGCCTC
GACAGGTCTTACATGATATGATAGAAGAATATACAGAAGAAATTAAGCTAGCAGGAGGTATTGGATGTTTTGAGAAAGGA
ATGCCATTACAATCCCGGTCTCCTATAGGCAACGACCAGAAAGAAAGTGACTTTGGATACAGTATACCATCAACAGATAA
GCAATGGAAAGGAGAGAACCGTGCAGATATTGAATATCCAATCGATAATAGACAAAATTCAGATAAAGTAAAGCGACATG
ATGAGTATGATTCAGGTAGCTCGCAGAGACAGCAGAGTCACAGATCATATAAGCACAGTGATCGAAGAGATGACAAGCTC
CGTGATCGAAGAAAGGACAAGCACAATGATCGAAGAGATGACGAATTCACAAGGACCAAACGACATAGCATTGAAGGGGA
ATCTTATCAAAACTACAGATCATCTCGTGAGAAGAGTTCTTCAGATTATAAGACCAAAAGGGATGATCCTTATGACCGCC
GCAGTCAGCAACCTAGGAATCAAAATTTGTTTGAAGATAGATACATACCAACAGAAAAAGAGTGA