Details for Arabidopsis Locus AT3G04140

Position : Chr3 ( 5`- 1086877 .. 1089229 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G04140

Protein [Map View]
MPPPIFPLRWESTGDQWWYASPIDCAAANGLYDVVIELLHQDTNLLVKLTSLRRIRRLETVWDDGDGNNFHVALNRSRVA
RRLLEECEIGNGDNSLIRAGYGGWLLYTAASAGDLEFVKKLLERDPLLVFGEGEYGVTDILYAAARGRSDDVFRLLLDFA
LLPADIAGVEEIDGEKLTEKQLIVKEEMVKRGVHSAARGGHVAILDELLLANKYDAVAKLRDAYGSTLLHSASSRAQIQV
VKYLISKYDSIMEVKDSHGNTALHIAAYKGHLDVVEALINESPPLISIVNGDGDTFLHTVVSGFAASGFKRLDRQMELLK
MLVSRSWSVDFSEIVNVRNCNGRTVIHLAVMDNLNAVRPDVVEILMRIPGVDLNVVDSYGMTAVDLLKRQTPQTVVSDLL
IKRLVSAGGRSNCGEKVSRLREERYGFCGSPGTSFEISDSEIFLFTAARTDKTAANAELSPDRESFDGISECSTEISTHS
KRKRRGGGGTGARLKLLLRWAKREESEENRRLSGDVNNRRVPLREMYSPSSCSRGKAFPMRTESGDLPSLSVRLKFTQGL
MKGVVVQESPRFVFSPPAVSDYSRAPSSACSTPFQTFSSELGRRTPAMKKQGSFMNRYLCFGGKGLAIDGSSEMISNGSG
HRPQSFKRVMSSLVSS*

DNA
ATGCCACCGCCGATATTTCCTCTCCGGTGGGAAAGTACCGGAGACCAGTGGTGGTACGCTTCACCAATCGATTGCGCCGC
CGCAAATGGTTTATACGACGTCGTCATCGAGCTGCTTCATCAAGATACAAACCTTCTCGTAAAACTCACCTCCCTCCGCC
GTATCCGCCGCCTCGAAACCGTCTGGGACGACGGAGACGGAAATAACTTCCATGTGGCTCTAAACCGCTCCCGCGTCGCG
AGAAGGCTATTGGAAGAGTGCGAAATCGGAAACGGAGACAATTCCCTCATCAGAGCTGGCTACGGTGGCTGGCTGCTGTA
CACAGCCGCTTCAGCTGGAGATTTAGAATTCGTTAAAAAGCTTTTAGAGAGAGATCCGCTTCTCGTGTTCGGAGAAGGAG
AGTACGGCGTCACTGATATCCTCTACGCGGCGGCACGAGGACGAAGCGACGACGTTTTCCGTCTTCTCCTCGATTTCGCG
TTGTTACCGGCTGATATCGCCGGCGTCGAAGAAATCGACGGCGAAAAATTAACAGAGAAACAGTTAATAGTCAAAGAAGA
GATGGTTAAAAGAGGGGTCCACAGTGCGGCGAGAGGCGGACACGTGGCAATCCTCGATGAACTCTTACTCGCTAACAAAT
ACGACGCCGTTGCAAAACTCAGAGATGCTTATGGTTCTACTCTGTTACACTCTGCTTCTAGCAGAGCTCAAATCCAAGTG
GTGAAGTATCTTATATCGAAGTATGATTCAATCATGGAGGTTAAAGACAGCCATGGAAACACAGCGTTGCATATAGCAGC
TTACAAGGGTCATTTAGATGTAGTGGAAGCTCTTATAAACGAATCTCCACCGTTGATTTCCATTGTTAATGGAGATGGTG
ACACGTTTCTTCACACGGTCGTGTCTGGTTTTGCTGCGTCTGGGTTTAAGCGGTTAGATCGGCAGATGGAGCTTTTGAAG
ATGTTAGTCTCAAGAAGCTGGTCCGTTGACTTTTCTGAGATTGTCAACGTTAGAAATTGTAACGGAAGAACTGTGATTCA
TTTAGCTGTGATGGATAATCTTAACGCCGTTAGACCTGACGTCGTTGAGATTCTGATGAGAATCCCTGGCGTTGATCTTA
ACGTCGTTGATTCTTATGGAATGACAGCCGTTGATTTGCTTAAACGACAAACGCCTCAAACGGTGGTTTCTGATTTGTTG
ATCAAACGGCTTGTATCCGCCGGTGGAAGATCAAACTGCGGTGAGAAAGTTTCGCGGTTGAGAGAAGAGCGTTATGGATT
CTGCGGTAGTCCAGGAACGTCGTTTGAGATATCTGATTCTGAGATCTTTCTATTTACGGCGGCGAGAACAGATAAAACCG
CTGCAAACGCTGAATTAAGTCCAGACAGAGAGAGTTTTGATGGAATTAGTGAGTGTTCAACTGAAATTTCGACGCATTCG
AAACGCAAACGCCGCGGTGGCGGCGGTACAGGAGCGCGTCTTAAGCTTCTTTTACGGTGGGCGAAGAGGGAAGAATCAGA
AGAAAATCGTCGTTTATCCGGAGATGTTAACAACCGTCGTGTTCCTCTCAGAGAGATGTATTCTCCGTCGTCTTGTAGCA
GAGGAAAAGCGTTTCCGATGAGAACAGAGAGTGGTGATCTTCCGAGTTTATCGGTGAGACTTAAATTCACACAAGGGTTA
ATGAAAGGAGTGGTGGTTCAGGAATCTCCGAGGTTCGTGTTTTCTCCTCCGGCTGTATCCGATTACTCTCGAGCTCCGTC
GTCGGCTTGTTCGACGCCGTTTCAGACGTTTTCTTCGGAATTAGGGCGAAGAACACCTGCCATGAAGAAACAGGGATCAT
TTATGAACAGATACTTGTGTTTTGGTGGTAAAGGACTAGCCATTGATGGTTCTTCTGAGATGATCAGTAATGGCTCTGGT
CATCGTCCCCAGAGTTTCAAACGAGTGATGTCGTCTTTGGTTTCTTCTTGA