Details for Arabidopsis Locus AT3G04120

Position : Chr3 ( 5`- 1080950 .. 1083530 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G04120

Protein [Map View]
MADKKIRIGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKYDSVHGQWKHNELKIKDEKTLLFGEKPVTV
FGIRNPEDIPWAEAGADYVVESTGVFTDKDKAAAHLKGGAKKVVISAPSKDAPMFVVGVNEHEYKSDLDIVSNASCTTNC
LAPLAKVINDRFGIVEGLMTTVHSITATQKTVDGPSMKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMSFRVP
TVDVSVVDLTVRLEKAATYDEIKKAIKEESEGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDKFVKLVSWYDN
EWGYSSRVVDLIVHMSKA*

DNA
ATGGCTGACAAGAAGATTAGGATCGGAATCAACGGATTCGGAAGAATTGGTCGTTTGGTTGCTAGAGTTGTTCTCCAGAG
GGACGATGTTGAGCTCGTCGCTGTCAACGACCCCTTCATCACTACTGAGTACATGACCTACATGTTCAAGTACGACAGTG
TTCACGGTCAATGGAAACACAATGAACTCAAGATCAAGGATGAGAAGACCCTTCTCTTCGGTGAGAAGCCAGTCACTGTT
TTCGGCATCAGGAACCCTGAGGATATCCCATGGGCCGAGGCTGGAGCTGACTACGTTGTTGAGTCTACTGGTGTCTTCAC
TGACAAAGACAAGGCTGCAGCTCACTTGAAGGGTGGTGCCAAGAAGGTTGTTATCTCTGCCCCCAGCAAAGACGCTCCAA
TGTTTGTTGTTGGTGTCAACGAGCACGAATACAAGTCCGACCTTGACATTGTCTCCAACGCTAGCTGCACCACTAACTGC
CTTGCTCCCCTTGCCAAGGTTATCAATGACAGATTTGGAATTGTTGAGGGTCTTATGACTACAGTCCACTCAATCACTGC
TACTCAGAAGACTGTTGATGGGCCTTCAATGAAGGACTGGAGAGGTGGAAGAGCTGCTTCATTCAACATTATTCCCAGCA
GCACTGGAGCTGCCAAGGCTGTCGGAAAGGTGCTTCCAGCTCTTAACGGAAAGTTGACTGGAATGTCTTTCCGTGTCCCA
ACCGTTGATGTCTCAGTTGTTGACCTTACTGTCAGACTCGAGAAAGCTGCTACCTACGATGAAATCAAAAAGGCTATCAA
GGAGGAATCCGAAGGCAAACTCAAGGGAATCCTTGGATACACCGAGGATGATGTTGTCTCAACTGACTTCGTTGGCGACA
ACAGGTCGAGCATTTTTGACGCCAAGGCTGGAATTGCATTGAGCGACAAGTTTGTGAAATTGGTGTCATGGTACGACAAC
GAATGGGGTTACAGTTCCCGTGTGGTCGACTTGATCGTCCACATGTCAAAGGCCTAA