Details for Arabidopsis Locus AT3G04100

Position : Chr3 ( 5`- 1075299 .. 1075922 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G04100

Protein [Map View]
MSSTKQAKGRKTKGKQKIEMKKVENYGDRMITFSKRKTGIFKKMNELVAMCDVEVAFLIFSQPKKPYTFAHPSMKKVADR
LKNPSRQEPLERDDTRPLVEAYKKRRLHDLVKKMEALEEELAMDLEKLKLLKESRNEKKLDKMWWNFPSEGLSAKELQQR
YQAMLELRDNLCDNMAHLRLGKDCGGSSSVRVGRRVSGGVRLFDREA*

DNA
ATGTCATCTACGAAGCAAGCAAAGGGAAGAAAAACAAAGGGGAAGCAAAAGATCGAGATGAAGAAGGTGGAGAACTATGG
AGATAGGATGATTACGTTCTCAAAACGTAAAACCGGAATTTTTAAGAAAATGAACGAGCTCGTAGCAATGTGTGACGTTG
AAGTGGCTTTCTTGATTTTCTCTCAACCCAAGAAGCCCTATACATTCGCACATCCGTCTATGAAGAAAGTGGCTGACCGG
TTAAAGAACCCTTCGAGACAAGAACCATTAGAGAGAGACGATACCAGACCCCTCGTCGAAGCTTATAAGAAACGAAGGCT
CCACGACCTCGTAAAAAAAATGGAGGCGCTCGAAGAGGAGCTTGCGATGGATCTAGAGAAGTTGAAACTGTTGAAGGAAT
CGAGAAATGAAAAGAAGTTAGATAAAATGTGGTGGAACTTTCCTTCGGAAGGTTTGAGCGCGAAGGAGCTGCAGCAAAGG
TACCAAGCGATGCTCGAGTTACGTGATAACTTATGCGACAATATGGCTCACTTACGATTGGGAAAAGACTGTGGTGGTTC
ATCTTCTGTTCGTGTGGGACGTCGAGTTTCTGGTGGTGTTCGTCTGTTCGATCGTGAAGCATGA