Details for Arabidopsis Locus AT3G04090

Position : Chr3 ( 5`- 1072092 .. 1074160 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G04090

Protein [Map View]
MMGVLKSAIGDMLMTFSWVVLSATFGIQTAAIISAGDFQAITWAPLVILTSLIFVYVSIFTVIFGSASFNPTGSAAFYVA
GVPGDTLFSLAIRLPAQAIGAAGGALAIMEFIPEKYKHMIGGPSLQVDVHTGAIAETILSFGITFAVLLIILRGPRRLLA
KTFLLALATISFVVAGSKYTGPAMNPAIAFGWAYMYSSHNTWDHIYVYWISSFVGALSAALLFRSIFPPPRPQKKKQKKA
*

DNA
ATGATGGGTGTGTTGAAGTCGGCGATTGGGGATATGTTGATGACCTTCTCTTGGGTTGTCCTCTCCGCTACCTTTGGAAT
TCAGACGGCGGCGATTATCTCCGCCGGTGATTTTCAGGCAATCACTTGGGCTCCGTTGGTGATTTTGACGTCGTTGATTT
TCGTCTACGTCTCGATCTTCACCGTTATCTTCGGTAGCGCTAGCTTCAATCCTACCGGAAGCGCTGCCTTTTATGTCGCC
GGTGTCCCCGGAGATACTCTTTTCTCCTTGGCGATTAGATTACCTGCTCAGGCAATTGGTGCTGCAGGAGGTGCATTGGC
GATCATGGAGTTCATACCAGAGAAATACAAGCATATGATTGGAGGTCCTTCTCTTCAGGTTGATGTGCACACTGGAGCTA
TTGCTGAAACGATCTTAAGTTTTGGTATTACCTTTGCGGTTTTGCTAATTATCCTCAGGGGTCCACGGAGATTGCTTGCT
AAGACGTTCTTGCTTGCTCTTGCAACCATCTCATTTGTTGTCGCCGGATCTAAATACACTGGACCAGCCATGAATCCTGC
CATTGCGTTTGGATGGGCATACATGTACAGCTCCCACAACACATGGGACCATATCTACGTCTACTGGATCAGTTCTTTCG
TAGGAGCATTATCTGCTGCATTGCTTTTCCGTTCTATCTTCCCGCCACCTCGGCCCCAGAAGAAGAAACAAAAGAAAGCC
TGA