Details for Arabidopsis Locus AT3G04080

Position : Chr3 ( 5`- 1067790 .. 1071295 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G04080

Protein [Map View]
MTAKRAIGRHESLADKVHRHRGLLLVISIPIVLIALVLLLMPGTSTSVSVIEYTMKNHEGGSNSRGPKNYAVIFDAGSSG
SRVHVYCFDQNLDLVPLENELELFLQLKPGLSAYPNDPRQSANSLVTLLDKAEASVPRELRPKTPVRVGATAGLRALGHQ
ASENILQAVRELLKGRSRLKTEANAVTVLDGTQEGSYQWVTINYLLRTLGKPYSDTVGVVDLGGGSVQMAYAIPEEDAAT
APKPVEGEDSYVREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSEDSNNPCIATGYAGTYKYGGKAFKAAASPSGASLD
ECRRVAINALKVNNSLCTHMKCTFGGVWNGGGGGGQKKMFVASFFFDRAAEAGFVDPNQPVAEVRPLDFEKAANKACNMR
MEEGKSKFPRVEEDNLPYLCLDLVYQYTLLVDGFGLKPSQTITLVKKVKYGDYAVEAAWPLGSAIEAVSSP*

DNA
ATGACGGCGAAGCGAGCGATCGGACGGCACGAATCCCTTGCTGACAAGGTCCATCGACATCGTGGTCTTCTACTTGTGAT
TTCGATCCCCATTGTGTTGATAGCTCTTGTGCTTCTGTTAATGCCGGGGACGTCGACGTCCGTCTCTGTCATCGAGTACA
CGATGAAAAACCACGAGGGAGGTTCCAATTCGAGGGGTCCGAAGAATTACGCTGTGATTTTTGATGCTGGAAGTTCTGGA
AGCCGTGTGCATGTTTACTGTTTCGATCAGAATTTGGATCTTGTTCCTTTGGAGAATGAGCTCGAGCTCTTCTTACAGCT
AAAACCGGGTTTAAGTGCATATCCTAATGATCCTCGGCAATCAGCAAACTCTTTAGTAACTCTTCTGGACAAAGCAGAAG
CTTCCGTTCCCCGTGAGTTGCGTCCAAAGACTCCTGTCAGAGTTGGGGCAACTGCAGGTTTGAGAGCTTTGGGTCACCAA
GCCTCTGAAAACATTTTGCAAGCGGTTAGGGAGCTCCTCAAAGGTAGAAGTAGGCTGAAGACTGAGGCAAATGCAGTGAC
TGTTCTGGATGGTACTCAGGAAGGATCTTATCAGTGGGTGACAATTAATTACTTGCTAAGGACTTTGGGAAAGCCGTACT
CGGACACAGTTGGAGTGGTTGATCTTGGAGGGGGGTCGGTTCAAATGGCATATGCTATACCAGAGGAAGATGCTGCAACT
GCACCAAAACCAGTAGAAGGCGAGGATTCTTATGTCAGAGAAATGTATTTGAAGGGACGAAAGTATTTCCTCTATGTTCA
TAGCTACCTACATTACGGGTTACTGGCTGCTCGGGCTGAGATTTTGAAAGTTTCTGAGGACTCTAACAACCCCTGTATCG
CGACTGGATATGCTGGTACCTACAAATATGGAGGAAAAGCGTTTAAAGCTGCAGCTTCTCCATCCGGTGCAAGTCTAGAT
GAGTGCCGGCGAGTAGCTATTAACGCACTCAAAGTCAATAATTCATTGTGTACACACATGAAATGCACTTTTGGTGGAGT
ATGGAATGGTGGAGGCGGTGGTGGCCAGAAGAAAATGTTTGTTGCATCATTTTTCTTCGATCGAGCCGCAGAGGCTGGTT
TTGTTGACCCAAACCAACCTGTGGCTGAGGTTCGACCACTTGACTTTGAGAAAGCGGCCAACAAAGCTTGTAACATGAGA
ATGGAAGAAGGGAAATCGAAGTTCCCACGTGTGGAGGAAGATAATCTTCCTTACTTGTGCTTGGATCTTGTTTACCAATA
TACTCTTCTCGTCGATGGATTCGGATTGAAGCCATCACAGACAATAACGTTAGTGAAGAAGGTGAAATACGGAGATTACG
CCGTGGAAGCTGCGTGGCCACTAGGAAGCGCCATAGAAGCAGTATCCTCACCATGA