Details for Arabidopsis Locus AT3G04060

Position : Chr3 ( 5`- 1053366 .. 1055163 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G04060

Protein [Map View]
MVEEGGVVVNQGGDQEVVDLPPGFRFHPTDEEIITHYLKEKVFNIRFTAAAIGQADLNKNEPWDLPKIAKMGEKEFYFFC
QRDRKYPTGMRTNRATVSGYWKATGKDKEIFRGKGCLVGMKKTLVFYTGRAPKGEKTNWVMHEYRLDGKYSYHNLPKTAR
DEWVVCRVFHKNAPSTTITTTKQLSRIDSLDNIDHLLDFSSLPPLIDPGFLGQPGPSFSGARQQHDLKPVLHHPTTAPVD
NTYLPTQALNFPYHSVHNSGSDFGYGAGSGNNNKGMIKLEHSLVSVSQETGLSSDVNTTATPEISSYPMMMNPAMMDGSK
SACDGLDDLIFWEDLYTS*

DNA
ATGGTGGAAGAAGGCGGCGTAGTTGTGAATCAAGGAGGAGATCAGGAGGTGGTGGATTTGCCTCCGGGGTTTCGGTTTCA
CCCTACTGATGAAGAGATAATAACTCACTACCTCAAAGAGAAGGTCTTCAACATCCGATTTACCGCGGCAGCGATTGGTC
AAGCCGACCTCAACAAGAACGAGCCATGGGATCTACCAAAGATTGCAAAGATGGGGGAGAAGGAGTTTTACTTTTTCTGC
CAGAGGGATCGGAAGTATCCGACCGGGATGAGGACGAACCGTGCGACCGTGTCTGGTTATTGGAAGGCGACCGGGAAGGA
CAAGGAGATCTTTAGAGGCAAAGGTTGTCTTGTTGGGATGAAGAAAACACTTGTTTTCTATACAGGAAGAGCTCCTAAAG
GTGAAAAGACCAATTGGGTTATGCATGAATATCGTCTTGATGGAAAATATTCTTATCATAACCTCCCCAAAACCGCAAGG
GATGAATGGGTGGTGTGTAGGGTTTTTCACAAGAACGCTCCTAGTACTACAATCACTACTACAAAACAACTCTCAAGGAT
TGATTCTCTTGATAACATTGATCATCTCTTAGACTTCTCATCTCTCCCTCCTCTCATAGATCCGGGTTTCTTGGGTCAAC
CCGGCCCAAGCTTCTCCGGTGCCCGTCAACAACACGATCTCAAACCTGTTCTCCACCATCCTACAACCGCACCAGTCGAC
AACACTTACCTTCCTACCCAAGCTCTCAATTTCCCTTACCACTCGGTCCATAATTCCGGATCTGATTTCGGCTACGGGGC
AGGTTCAGGCAATAATAACAAAGGTATGATCAAGTTGGAGCATTCTCTTGTGAGTGTGTCTCAAGAAACCGGTTTGAGTT
CCGATGTGAACACAACCGCAACGCCAGAGATATCTTCTTATCCAATGATGATGAATCCGGCAATGATGGATGGTAGCAAG
TCAGCGTGTGATGGTCTTGATGACTTGATCTTCTGGGAAGATTTATATACTAGCTAA