Details for Arabidopsis Locus AT3G04030

Position : Chr3 ( 5`- 1042882 .. 1044698 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G04030

Protein [Map View]
MYYQNQHQGKNILSSSRMHITSERHPFLRGNSPGDSGLILSTDAKPRLKWTPDLHERFIEAVNQLGGADKATPKTIMKVM
GIPGLTLYHLKSHLQKYRLSKNLNGQANNSFNKIGIMTMMEEKTPDADEIQSENLSIGPQPNKNSPIGEALQMQIEVQRR
LHEQLEVQRHLQLRIEAQGKYLQSVLEKAQETLGRQNLGAAGIEAAKVQLSELVSKVSAEYPNSSFLEPKELQNLCSQQM
QTNYPPDCSLESCLTSSEGTQKNSKMLENNRLGLRTYIGDSTSEQKEIMEEPLFQRMELTWTEGLRGNPYLSTMVSEAEQ
RISYSERSPGRLSIGVGLHGHKSQHQQGNNEDHKLETRNRKGMDSTTELDLNTHVENYCTTRTKQFDLNGFSWN*

DNA
ATGTATTACCAAAACCAGCACCAAGGAAAGAACATCCTCTCATCTTCAAGAATGCATATAACTTCTGAAAGGCATCCATT
CCTTAGAGGGAATAGTCCAGGTGATTCTGGACTTATCCTATCAACCGATGCAAAGCCACGCCTAAAATGGACTCCAGATC
TTCATGAGAGATTCATTGAAGCAGTCAATCAACTCGGTGGAGCAGATAAAGCTACTCCTAAGACAATCATGAAAGTCATG
GGGATTCCAGGCCTTACCTTATACCATCTCAAAAGTCATCTTCAGAAATACAGGCTGAGCAAGAATCTCAACGGACAAGC
TAACAACAGCTTCAACAAAATAGGTATAATGACCATGATGGAAGAAAAGACTCCTGATGCAGACGAAATTCAAAGCGAGA
ATTTAAGCATTGGACCACAGCCAAACAAGAATTCACCAATAGGTGAAGCACTGCAAATGCAAATAGAGGTCCAAAGAAGG
CTTCATGAGCAACTTGAGGTACAGCGACATTTGCAGCTTAGGATAGAGGCTCAAGGGAAGTACCTGCAATCGGTTTTGGA
GAAAGCACAAGAGACTCTTGGAAGACAGAACCTCGGTGCAGCTGGGATCGAAGCTGCCAAAGTTCAACTCTCGGAACTAG
TATCTAAAGTATCAGCAGAGTACCCAAACTCTAGTTTCCTAGAACCAAAAGAACTTCAAAACCTATGCTCACAACAGATG
CAAACAAACTATCCACCTGATTGCTCTCTTGAAAGTTGCCTGACCTCAAGCGAGGGAACGCAGAAAAACTCGAAAATGCT
AGAGAACAACAGATTAGGACTAAGAACGTATATTGGTGATTCAACATCGGAGCAGAAAGAGATTATGGAAGAACCATTGT
TCCAAAGAATGGAGCTCACATGGACAGAAGGTCTAAGAGGGAATCCATATCTTTCAACAATGGTGAGTGAAGCAGAACAA
AGAATCTCATATTCAGAAAGAAGTCCAGGTAGATTATCAATAGGAGTAGGATTGCACGGACACAAAAGCCAACATCAACA
AGGCAACAATGAGGATCATAAGCTTGAAACACGAAACCGGAAAGGCATGGATTCAACAACAGAGCTAGATCTCAACACAC
ATGTTGAAAACTATTGTACAACGCGTACGAAACAGTTCGACTTGAATGGTTTCAGCTGGAACTGA