Details for Arabidopsis Locus AT3G03980

Position : Chr3 ( 5`- 1031742 .. 1033207 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G03980

Protein [Map View]
MSTHSSISQPPLPLAGRVAIVTGSSRGIGRAIAIHLAELGARIVINYTSKAADAERVASEINDFPVREEITGKGPRAIVV
QANVSEPSQVKSMFDAAESAFEAPVHILVNSAGILDPKYPTIADTSVEDFDHTFSVNTKGAFLCSKEAANRLKQGGGGRI
ILLTSSQTRSLKPGFGAYAASKAAVETMVKILAKELKGTGITANCVAPGPIATEMFFDGKTPELVEKIAAESPFGRVGEA
KDVVPLVGFLAGDGGEWVNGQIIPVNGGYV*

DNA
ATGTCTACACATTCATCAATCTCGCAACCGCCGCTTCCTCTCGCCGGAAGAGTCGCCATTGTCACCGGCTCTTCCCGTGG
TATTGGCCGAGCGATAGCGATCCACTTAGCTGAACTCGGTGCGAGGATTGTTATCAACTACACCTCTAAAGCCGCAGACG
CCGAGCGTGTCGCGTCGGAGATCAATGATTTTCCAGTTAGGGAAGAAATCACTGGAAAGGGACCAAGAGCTATTGTGGTT
CAGGCCAATGTCTCTGAGCCAAGCCAGGTTAAATCAATGTTTGATGCGGCGGAGAGTGCCTTTGAAGCGCCGGTTCACAT
TCTGGTTAACTCTGCTGGGATTCTCGATCCAAAGTACCCTACGATCGCAGACACATCAGTCGAAGATTTCGATCATACGT
TCAGTGTCAACACAAAAGGAGCGTTCCTGTGTAGCAAGGAAGCTGCCAATAGGCTAAAACAAGGAGGTGGTGGTCGGATC
ATACTTCTGACATCTTCCCAGACTCGATCTTTAAAGCCAGGGTTTGGTGCCTATGCCGCATCAAAGGCAGCTGTGGAAAC
TATGGTCAAGATTCTTGCAAAAGAGCTCAAAGGAACAGGAATCACTGCAAACTGTGTTGCTCCAGGACCCATCGCCACTG
AGATGTTCTTTGATGGAAAGACCCCAGAGTTGGTGGAAAAGATAGCCGCAGAGTCTCCCTTTGGGAGGGTCGGCGAAGCC
AAAGACGTGGTGCCTCTTGTTGGATTCTTGGCTGGTGACGGTGGTGAATGGGTCAATGGTCAAATCATTCCTGTTAATGG
TGGATATGTATAA