Details for Arabidopsis Locus AT3G03970

Position : Chr3 ( 5`- 1027997 .. 1030605 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G03970

Protein [Map View]
MGRNLGSAFRQELANLDKDPDSHKTAMSNLRSIVKDLDAKVVHVFVAQLSDVKEIGLESGGYTVSLFEDLARAHGVKIAP
HIDIIMPAIIRTLSSSEGSLRVQQACSRAVAAMARYGIDPTTPEDKKTNVIHSLCKPLSDSLIDSQHQQHLALGSALCLK
SLVDCDNWRSASSEMVNNVCQSLAVALEATSSEAKSHMALVMALSKHNPFTVEAYARLFVKSGLRILDLGVVEGDSQKRL
LAIQMLNFLMKNLNPKSISSELELIYQEMEKYQKDQHYVKMAAHETMRQAERLICEADPMFDAENCKPRNSLSGSVKSTS
SLREHDGSVYSRQDRSYVNDQDEYDVLFSGVASGRTLVSGSPLVTFGDNNQETGFVIESPRIGDQIQCSGVENGNIESVW
FHQRNRSSEFNESVCSRTNRSRSSRRNTKKRQSGDICSKHHRHGFAQDPFTELLDNRQQLLQYSETSSSSSIYDTSGTTT
PTNTTEDICEKPKTDLDSEAKLKTVETELDPRLGRSKGVLKLGLSVFSIAVAGFASFMWMYLQDDMMPPHLVPT*

DNA
ATGGGAAGAAATCTTGGTTCGGCATTTAGACAAGAGTTGGCTAATCTTGACAAAGATCCAGATTCCCACAAGACTGCAAT
GAGCAATTTGAGATCGATTGTGAAAGATTTGGATGCAAAGGTGGTTCATGTTTTTGTTGCTCAACTTTCTGATGTCAAAG
AGATTGGGTTGGAGTCTGGTGGTTACACTGTATCTCTCTTTGAAGACCTTGCTCGTGCTCATGGAGTCAAGATTGCTCCT
CATATAGACATTATCATGCCGGCGATTATAAGAACATTGAGCTCCAGTGAAGGGTCTTTACGTGTTCAACAGGCTTGCTC
AAGGGCAGTAGCTGCTATGGCTAGATATGGAATTGATCCTACAACACCAGAAGATAAGAAAACGAATGTGATTCATTCTC
TTTGCAAGCCACTCTCTGATTCTCTTATAGATTCGCAACATCAACAGCATCTTGCTTTGGGATCTGCTCTTTGCTTGAAG
TCACTTGTGGATTGCGATAATTGGCGATCTGCTTCTAGTGAAATGGTTAATAATGTTTGTCAAAGCTTAGCTGTTGCTCT
TGAAGCTACTTCAAGTGAAGCTAAGTCTCATATGGCACTTGTTATGGCACTTTCCAAGCACAATCCTTTTACTGTCGAGG
CATATGCAAGGCTTTTTGTGAAGTCGGGTCTGAGGATTCTGGATTTAGGTGTTGTTGAGGGAGATTCTCAGAAACGGCTT
TTAGCTATACAGATGCTCAACTTTCTGATGAAGAATCTGAATCCCAAGAGTATTTCTTCTGAGTTAGAGCTTATATATCA
AGAGATGGAGAAATACCAAAAAGATCAGCATTATGTCAAAATGGCAGCTCATGAAACCATGAGACAAGCAGAGAGATTAA
TATGTGAGGCAGATCCGATGTTTGATGCAGAGAACTGCAAGCCCCGAAACTCGCTCAGCGGATCAGTCAAGTCTACATCA
AGTCTGCGAGAACATGATGGGAGTGTCTATAGTAGACAAGATAGGAGTTATGTAAACGATCAAGACGAGTATGATGTTTT
GTTTTCTGGTGTAGCCAGTGGAAGAACTCTTGTCTCAGGCTCTCCTCTGGTGACTTTCGGAGACAATAACCAAGAAACTG
GTTTTGTTATCGAGAGTCCAAGAATTGGAGATCAGATTCAATGTTCTGGTGTTGAAAATGGCAACATTGAGTCAGTTTGG
TTCCATCAGCGGAACAGAAGCTCCGAGTTTAATGAATCTGTGTGCTCTAGGACCAACCGCTCAAGAAGTTCAAGACGAAA
CACCAAGAAGAGACAATCAGGAGACATTTGTTCAAAACATCACAGGCATGGTTTCGCACAAGATCCATTCACTGAGTTAC
TAGATAACAGACAGCAGCTGCTACAGTACAGTGAAACCTCGTCATCATCATCAATATATGATACCTCTGGTACTACAACT
CCAACCAACACAACAGAAGATATCTGTGAGAAACCAAAAACAGATTTGGATTCTGAGGCCAAACTTAAGACAGTGGAGAC
TGAACTAGACCCACGTCTGGGACGGAGCAAGGGTGTGTTAAAATTGGGATTGAGTGTCTTCTCTATTGCAGTTGCAGGGT
TTGCTTCTTTCATGTGGATGTATCTCCAGGATGATATGATGCCTCCTCATCTTGTTCCGACTTAA