Details for Arabidopsis Locus AT3G03930

Position : Chr3 ( 5`- 1011414 .. 1012810 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G03930

Protein [Map View]
MRPPISSGRIGDGGLDSCPEKKEEEKDSTSRLCSDLSDLRIERIGSTPAFQWISVYTKRPPMKQRFHHNIANSRLSHHAE
KGKRDGLFISCVASEANLWALVMDAGTGFTSQVYKFSSTFLPKDWIMKQWEKNYYISSIAGANNGSSLVVMSKGTRYIQQ
SYKTGDSIPLKWMDKKWKEGFHVTSMTTGGSRWGVVMSRNSGFSEQVMEVDFLNPSEDINRRLESGYMITSMAATADQAA
LILSIPRRKITDEIQETLRTSSFPSSYVKDKWGKNMFITSICYGRTV*

DNA
ATGAGACCACCGATTAGCAGCGGAAGAATTGGTGATGGCGGACTTGATTCATGCCCTGAGAAGAAAGAGGAAGAGAAAGA
CTCAACAAGTAGACTTTGTTCGGATTTGAGTGATTTACGAATAGAAAGAATCGGAAGTACTCCTGCGTTCCAATGGATTT
CAGTCTATACCAAACGTCCTCCTATGAAACAGAGATTTCACCACAACATTGCAAATTCAAGGTTGTCGCATCATGCAGAA
AAAGGTAAAAGGGATGGCCTTTTCATAAGCTGTGTAGCATCAGAAGCTAATCTCTGGGCCTTAGTCATGGATGCTGGAAC
TGGTTTCACTTCTCAAGTTTATAAATTTTCTTCTACCTTCCTCCCCAAGGACTGGATTATGAAACAATGGGAGAAGAACT
ACTATATCAGTTCCATAGCTGGTGCAAATAATGGGAGCTCATTGGTCGTTATGTCAAAAGGAACTCGTTATATCCAGCAA
TCATACAAAACCGGTGACTCAATTCCATTAAAGTGGATGGATAAAAAGTGGAAAGAAGGTTTTCATGTAACATCCATGAC
CACGGGTGGGAGCCGTTGGGGTGTAGTAATGTCCAGGAACTCAGGCTTCTCTGAACAGGTGATGGAGGTTGACTTTTTGA
ACCCAAGTGAAGATATAAATCGAAGGTTGGAAAGTGGATACATGATAACATCAATGGCTGCAACAGCTGATCAAGCAGCT
CTTATATTGAGTATACCTAGACGTAAAATAACCGATGAAATCCAAGAGACTTTACGCACTTCTTCCTTCCCTAGCTCCTA
TGTCAAGGACAAATGGGGGAAAAATATGTTCATAACATCAATATGTTATGGTCGGACAGTTTGA