Details for Arabidopsis Locus AT3G03910

Position : Chr3 ( 5`- 1006842 .. 1009018 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G03910

Protein [Map View]
MNALAATNRNFKLASRLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDNARGPMKGGIRYHPEVEPDEV
NALAQLMTWKTAVAKIPYGGAKGGIGCDPSELSLSELERLTRVFTQKIHDLIGIHTDVPAPDMGTGPQTMAWILDEYSKF
HGHSPAVVTGKPIDLGGSLGRDAATGRGVLFATEALLNEHGKTISGQRFAIQGFGNVGSWAAKLISDKGGKIVAVSDVTG
AIKNNNGIDILSLLEHAEENRGIKGFDGADSIDPDSILVEDCDILVPAALGGVINRENANEIKAKFIIEGANHPTDPEAD
EILKKKGVMILPDIYANSGGVTVSYFEWVQNIQGFMWDEEKVNRELKTYMTRGFKDLKEMCQTHSCDLRMGAFTLGINRV
AQATTIRGWGS*

DNA
ATGAATGCTTTAGCAGCAACCAACAGAAACTTCAAGCTTGCTTCTAGGCTTCTTGGTTTAGACTCAAAGCTCGAGAAAAG
TCTTCTCATTCCCTTCAGAGAGATCAAGGTGGAATGTACCATACCAAAAGACGATGGAACTCTAGCATCCTTTGTTGGAT
TCAGAGTTCAACACGACAATGCAAGAGGTCCCATGAAAGGTGGAATCAGATATCATCCAGAGGTTGAACCGGATGAAGTA
AACGCTTTGGCTCAACTTATGACATGGAAAACAGCAGTGGCTAAGATACCTTATGGAGGAGCCAAAGGAGGAATCGGTTG
TGACCCGAGCGAGCTAAGTCTCTCAGAGCTCGAACGTTTGACTCGAGTTTTCACTCAGAAGATTCACGATCTTATTGGGA
TTCATACTGATGTTCCAGCTCCTGATATGGGAACCGGTCCTCAGACAATGGCTTGGATTCTTGATGAATACTCAAAATTC
CATGGACATTCTCCTGCTGTTGTCACTGGAAAACCCATTGATCTTGGTGGATCTCTTGGGAGAGATGCTGCTACAGGAAG
AGGAGTGTTGTTTGCAACAGAAGCTTTACTCAACGAACATGGAAAGACCATATCTGGACAGCGATTCGCCATCCAGGGCT
TTGGAAATGTGGGTTCTTGGGCAGCGAAGTTGATAAGTGACAAAGGTGGTAAGATTGTGGCGGTGAGTGATGTCACAGGA
GCAATCAAGAACAATAATGGAATTGACATCTTGAGTTTGCTCGAGCATGCTGAAGAAAACAGAGGAATCAAAGGGTTTGA
TGGTGCTGATTCAATCGATCCTGATTCGATTCTTGTCGAAGATTGTGATATTCTTGTCCCTGCAGCTCTAGGGGGAGTCA
TCAACAGGGAAAATGCAAACGAAATAAAAGCCAAATTCATCATTGAAGGTGCTAATCACCCAACTGATCCTGAGGCTGAC
GAGATCTTGAAGAAGAAAGGTGTTATGATCCTCCCAGATATATACGCAAACTCAGGAGGAGTCACTGTAAGTTACTTCGA
GTGGGTTCAGAACATACAAGGATTCATGTGGGATGAGGAAAAGGTGAATAGGGAGCTAAAGACCTACATGACTCGCGGGT
TCAAAGACTTGAAAGAAATGTGTCAGACGCACTCATGTGATCTCCGTATGGGAGCTTTCACCCTCGGTATTAATCGTGTC
GCTCAAGCTACCACTATCAGAGGCTGGGGTTCTTGA