Details for Arabidopsis Locus AT3G03890

Position : Chr3 ( 5`- 999467 .. 1002484 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G03890

Protein [Map View]
MKSLVAHFSTPLITARLVPRCIIHRASISAVSFSTVRRRFSPLTMASAAQSSSQAVSYGSGNSDTDVFKLIQAHEEKAAR
LSPVEEIRTVLNGSICGMLSTFSQKYEGYPSGSMVDFACDADGSPILAVSSLAVHTKDLLANPKCSLLIARDPEDRTGLR
ITLHGDAVLVSEKDQAAVRSAYLAKHPKAFWVDFGDFSFMRIEPKVVRYVSGVATAFLGSGEFSKEEYQAAKVDPIAQYA
KPVTSHMNKDHEEDTKAIVHNITSIPVESALMLDLDSLGFNVKATLQGNTFKLRVPFPRRAQDRKDVKTLIVEMLQAAKS
N*

DNA
ATGAAGTCGCTTGTGGCTCATTTCTCAACGCCTTTAATCACCGCTAGATTAGTTCCTAGATGTATCATCCATCGAGCTTC
AATCTCCGCCGTCTCTTTTTCCACCGTCCGCCGTCGATTTTCTCCTCTCACCATGGCCTCAGCAGCTCAGTCTTCTTCTC
AGGCTGTGTCTTACGGGAGTGGCAACAGTGATACAGATGTTTTTAAATTGATTCAAGCTCACGAGGAGAAGGCTGCTCGT
CTTTCCCCAGTCGAAGAAATCCGAACTGTGCTTAATGGTAGCATATGCGGTATGCTTTCCACTTTTTCTCAGAAGTATGA
GGGTTATCCTTCAGGGTCAATGGTTGATTTTGCATGTGATGCTGATGGTTCTCCGATTCTGGCAGTTAGTAGCTTGGCAG
TTCATACAAAGGATCTCTTAGCTAATCCAAAATGCTCATTACTAATTGCTAGAGACCCAGAGGATAGGACTGGTTTGAGG
ATCACCTTACATGGTGATGCAGTGTTGGTTTCTGAAAAAGATCAAGCAGCTGTTCGATCTGCCTATTTAGCCAAGCATCC
CAAAGCTTTCTGGGTTGATTTTGGGGACTTCAGCTTTATGCGAATTGAACCGAAAGTGGTCAGATATGTTTCAGGGGTTG
CAACTGCTTTTCTTGGATCTGGAGAATTTAGCAAAGAGGAGTACCAAGCAGCCAAAGTCGATCCTATAGCTCAGTATGCA
AAACCTGTAACGTCTCACATGAATAAAGACCATGAAGAGGATACCAAAGCCATTGTACATAATATAACATCCATACCTGT
GGAAAGCGCCTTGATGCTGGATTTGGATAGCCTTGGTTTCAATGTTAAGGCTACTCTTCAAGGGAACACCTTCAAACTCC
GAGTTCCGTTTCCAAGACGCGCACAAGACAGAAAGGATGTAAAGACATTGATTGTGGAAATGCTTCAAGCTGCCAAGTCC
AATTAG