Details for Arabidopsis Locus AT3G03870

Position : Chr3 ( 5`- 995217 .. 997410 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G03870

Protein [Map View]
MDLEDWELVLPKNSFKDLDLDHDEDHHGAMVMDYFLCPSTKDPLPKTESPPRSKVVPKKILQVPIAWEAVLDQDNTKIPN
NPDLEPDPHPDPDSKPTLSTDSVSSPRVSFKIMKDTEFADMKIDPPARITSPLPQIDDAASKPSDLEGGDDLRDKKEVVL
EEEDEDGSGGERLNLWKAGLNGIGAICSFGVAAAAATVCVFFLGHNNIKICKNKNQMLRFQIYSDDNKRMKEVVNHATKL
NEAIFGMKGVPVVRAQISFGGHYDGL*

DNA
ATGGATCTCGAGGATTGGGAATTAGTACTCCCCAAGAACAGCTTCAAGGATCTTGATCTTGATCATGACGAGGATCATCA
TGGAGCCATGGTGATGGACTACTTCCTCTGCCCATCTACTAAAGATCCTCTCCCCAAGACAGAGTCTCCTCCAAGATCCA
AAGTGGTCCCTAAAAAGATTCTTCAAGTTCCCATAGCTTGGGAAGCCGTGTTGGATCAAGACAACACGAAGATACCCAAT
AACCCTGATCTTGAACCGGATCCGCATCCGGATCCGGATTCAAAACCGACCCTTTCGACGGACTCTGTTTCGTCACCAAG
AGTTTCCTTCAAGATCATGAAGGACACTGAATTTGCCGACATGAAAATTGACCCACCAGCGAGGATCACGAGTCCTCTGC
CTCAGATCGATGATGCTGCTTCGAAACCCTCTGATTTAGAAGGAGGGGATGACTTGCGAGACAAGAAAGAAGTTGTTTTG
GAGGAAGAAGATGAAGATGGTAGTGGTGGTGAGAGATTGAATCTGTGGAAGGCTGGTCTCAATGGGATTGGAGCAATCTG
TTCTTTTGGGGTTGCAGCTGCTGCTGCTACCGTATGTGTCTTCTTCCTCGGACACAACAATATCAAAATCTGTAAGAACA
AGAACCAGATGCTTCGGTTCCAGATTTACTCCGATGATAATAAGAGGATGAAAGAAGTTGTGAATCATGCAACAAAGCTC
AATGAAGCAATCTTTGGTATGAAAGGTGTTCCTGTCGTAAGAGCTCAAATATCTTTTGGGGGTCACTACGATGGACTTTG
A