Details for Arabidopsis Locus AT3G03810

Position : Chr3 ( 5`- 971672 .. 976367 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G03810

Protein [Map View]
MVFKSRIKWIALFVLILSMGSLVVHLSMTKSSGVQLAYSARDNLWQDFDSLLGAQDFRNKHLWRPVKSLETLQPYANPRN
SYPAPSSKNNGFIYAKIFGGFDKIRSSICDLVTISRLLNATLVIPELQESLRSKGISNKFKSFSYLYDEEQFIAFLKNDV
IVMKTLPESLKAARKRNEFPLFKPKNSASPKFYLEDVLPKLKKANVIGLIVSDGGCLQSALPASMPELQRLRCRVAFHAL
QLRPEIQVLAKEMVDRLRKSGQPFLAYHPGLVREKLAYHGCAELFQDIHSELIQYRRAQMIKQRFILEELIVDSRLRRDN
GLCPLMPEEVGILLKALGYSQKAIIYLAGSEIFGGQRVLIPLRAMFPNLVDRTSLCSTEELSELVGPETPLPENTYKMPP
RKSDKQLKEEWNKAGPRPRPLPPPPDRPIYQHEKEGWYGWLTENDTEPSPSPMDLRNQAHRLLWDALDFAVSVEADVFFP
GFNNDGSGWPDFSSLVMGQRLYERPSSRTYRLDRKVIQELFNITREDMYHPNRNWTLRVRKHLNSSLGESGLIRQSMLSK
PRSFLSHPLPECSCRTSALEDSRQIQSDDGRFLYGGEDECPKWIKSAGVEKSKTDDGDQPDYDHDLLAEQSETEEEFAKS
KVASAFDQDEEWDPND*

DNA
ATGGTGTTTAAATCTAGAATAAAATGGATTGCGCTATTTGTGTTGATCTTATCAATGGGATCTCTGGTTGTTCATCTTTC
CATGACGAAGTCTTCAGGTGTACAGTTGGCGTATTCTGCAAGAGATAACCTTTGGCAGGATTTTGATTCTTTGTTAGGTG
CACAGGATTTTAGAAATAAGCACTTATGGCGGCCTGTCAAATCGTTAGAGACCTTGCAGCCTTATGCCAATCCAAGAAAT
AGTTATCCTGCGCCCAGTTCGAAAAACAATGGTTTCATTTATGCAAAGATATTTGGTGGATTTGACAAGATTAGATCTTC
TATATGTGATCTTGTCACCATATCCAGGCTTCTAAATGCTACTCTTGTCATTCCAGAGCTTCAAGAAAGTCTTCGCTCAA
AAGGCATTAGCAACAAGTTCAAGAGTTTCTCCTATCTTTATGATGAAGAGCAGTTTATAGCCTTTCTTAAAAATGATGTT
ATAGTTATGAAGACCCTCCCTGAGAGCTTGAAAGCCGCAAGAAAAAGGAATGAGTTCCCTCTTTTTAAGCCCAAAAACTC
TGCGTCACCAAAATTTTACCTCGAGGATGTGTTGCCAAAGTTAAAGAAAGCTAATGTTATTGGATTGATCGTCTCTGATG
GGGGATGCTTGCAGTCAGCTTTGCCCGCTTCAATGCCTGAACTTCAAAGATTAAGGTGTAGAGTTGCCTTCCATGCCCTC
CAGCTTCGTCCAGAAATTCAGGTGCTGGCCAAGGAGATGGTTGACAGGTTACGTAAATCAGGTCAACCTTTCCTAGCTTA
TCATCCTGGCTTAGTAAGGGAGAAATTGGCATATCATGGTTGTGCTGAGCTTTTCCAGGATATTCACAGTGAACTCATCC
AATATCGGCGTGCTCAGATGATCAAGCAGAGGTTTATTTTAGAAGAACTTATTGTAGACTCGCGCTTGCGCAGGGATAAT
GGCTTATGTCCTCTCATGCCAGAAGAGGTTGGAATTCTTTTGAAAGCATTGGGTTATTCTCAAAAAGCGATCATATACTT
GGCTGGTTCTGAAATATTTGGCGGCCAACGGGTTTTGATCCCTCTACGTGCCATGTTCCCTAATTTAGTGGATCGGACTT
CTTTATGCAGCACGGAGGAATTATCAGAATTGGTTGGTCCTGAGACACCTCTTCCAGAGAATACATATAAAATGCCTCCT
CGAAAAAGCGATAAGCAGCTCAAGGAAGAGTGGAACAAGGCAGGTCCTCGACCTCGACCTCTACCTCCTCCTCCAGACAG
ACCTATCTACCAGCACGAAAAAGAAGGATGGTATGGTTGGCTTACAGAGAATGACACAGAACCAAGCCCTTCGCCTATGG
ATCTTAGGAATCAAGCACACAGGTTACTGTGGGATGCCCTTGATTTTGCTGTTTCTGTAGAAGCTGATGTGTTCTTCCCT
GGGTTCAACAACGATGGTAGTGGATGGCCAGATTTTTCAAGTTTGGTGATGGGTCAAAGGCTCTATGAAAGACCCTCTTC
ACGAACATATAGACTGGACAGGAAAGTTATTCAAGAACTTTTCAACATTACTCGTGAGGACATGTACCATCCCAACCGTA
ACTGGACACTTCGTGTGAGGAAACATCTTAACTCAAGTTTGGGTGAAAGTGGGCTTATCAGGCAGTCTATGTTGTCGAAA
CCTAGGTCGTTCCTTTCGCATCCACTTCCTGAATGCTCATGCAGAACCTCAGCCCTTGAGGATTCCAGGCAAATACAGAG
TGATGATGGTAGATTTCTCTATGGAGGTGAGGATGAATGCCCTAAATGGATAAAATCAGCGGGAGTGGAAAAGAGTAAAA
CTGATGATGGTGATCAGCCTGATTATGACCATGACCTTCTCGCTGAACAGTCAGAAACTGAAGAAGAATTTGCAAAAAGT
AAGGTAGCTTCAGCTTTTGACCAAGATGAAGAGTGGGATCCTAATGACTAG