Details for Arabidopsis Locus AT3G03776

Position : Chr3 ( 5`- 954144 .. 954760 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G03776

Protein [Map View]
MFPFQSLRFIEQIVIVANVSFMIDKQSKTVYLSGKVDPQIILEKITKAGKKAVILWSNNGQSKQPENRKDHLMEQRYASG
HINVPDGFSNYHPPYMNGPNGFSNYHLPDYWMNQPQLYNPTICPPPPPPYPRQVHPQPPAPPPYKFHQKEPVAKSFPPTP
APPKNFTMGDLQLCRIM*

DNA
ATGTTTCCGTTTCAATCTCTTCGCTTTATCGAACAAATCGTTATTGTAGCCAATGTGAGTTTCATGATCGACAAGCAAAG
CAAAACAGTATATCTATCGGGAAAAGTCGACCCACAAATAATACTTGAAAAGATTACAAAAGCAGGCAAAAAAGCGGTTA
TATTATGGAGCAATAACGGACAGAGTAAGCAGCCGGAAAATCGGAAAGACCATTTGATGGAACAACGTTATGCGTCGGGA
CACATAAATGTTCCTGATGGTTTCTCAAACTATCATCCGCCATACATGAATGGTCCTAATGGTTTCTCAAACTATCATCT
GCCGGATTATTGGATGAATCAACCTCAACTATACAATCCCACTATATGTCCCCCACCACCACCACCGTATCCACGTCAGG
TCCATCCGCAGCCACCAGCACCACCACCGTACAAATTCCATCAGAAAGAACCGGTGGCTAAGAGTTTCCCGCCTACACCA
GCTCCGCCTAAAAACTTTACGATGGGAGATTTGCAACTATGCCGGATAATGTGA