Details for Arabidopsis Locus AT3G03773

Position : Chr3 ( 5`- 951628 .. 953840 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G03773

Protein [Map View]
MCDRYRFKGFNICLLKSIAVFLHPPFIIPAPFIQNLHLAENMSSKLRIFVIDIRMIRNPEVLWAQRSDKVYLTVALPDAK
DISVKCEPQGLFSFSALGAQGERFEFSLELYGKIMTEYRKNVGLRNIIFSIQKEERSWWTRLLKSEEKPAPYIKVDWNKW
CDEDEEVNSETASDDESAFVNQDSESSDDDGLLYLPDLEKARNK*

DNA
ATGTGTGATAGGTATCGTTTCAAAGGTTTCAACATTTGTCTCTTGAAATCGATCGCCGTTTTTCTCCATCCTCCGTTCAT
AATTCCGGCACCGTTTATCCAAAATCTACACTTGGCTGAAAACATGAGTTCAAAATTGAGAATCTTTGTGATTGATATTC
GTATGATTCGTAATCCGGAGGTTCTTTGGGCTCAGCGTTCTGATAAAGTTTACCTAACTGTCGCCTTACCTGATGCGAAG
GACATTTCGGTGAAGTGTGAGCCTCAGGGTCTATTCAGTTTCTCTGCTCTTGGTGCCCAAGGCGAGCGCTTTGAATTCAG
CTTGGAGTTATATGGGAAGATTATGACAGAATATCGGAAGAATGTAGGACTAAGGAACATCATATTTTCAATTCAGAAAG
AAGAGAGAAGCTGGTGGACACGACTGCTGAAATCGGAAGAGAAACCTGCACCTTACATCAAAGTCGACTGGAATAAATGG
TGTGATGAGGATGAGGAGGTCAACTCTGAAACAGCCTCTGATGATGAGAGTGCATTTGTTAATCAAGATAGTGAAAGCAG
CGATGACGATGGATTGCTCTATCTTCCTGATCTGGAAAAGGCAAGAAACAAGTAG