Details for Arabidopsis Locus AT3G03770

Position : Chr3 ( 5`- 945135 .. 949042 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G03770

Protein [Map View]
MEKLYCGMPLLLLVLLLASIDGSTQLQSSQSQTLLRLQQLLYYPKVLNSWNNYTDFCNSEPSPSLTVVCYEDSVTQLHII
GDNGTHMLPKSFSINSFVTTLVKLPDVKVLTFVSLGLWGWLPQKINRLSSLEILNVSSNFLFGPIPHELSSLATLQTLIL
DENMFSGELPDWIDSLPSLAVLSLRKNVLNGSLPSSLSSLSGLRVLALANNRFNGALPDLSHLTNLQVLDLEGNSFGPLF
PRLSNKLVTLILSKNKFRSAVSAEEVSSLYQLQHLDLSYNTFVGPFPTSLMSLPAITYLNISHNKLTGRLSANLSCNSQL
MFVDMSSNLLTGSLPTCLKPSSGTSRDVVYASNCLATTNEDQRPVSFCSNEALAVGILPQRRNKVSKVGIALGVTASILG
VLLLAGALFVVLRRLNAKKTVTKSSPRLIRENASMGYTSKLLSDARYISQTMKLGGLGLPAYRTFSLEELEYATNNFESS
AFMGEGSQGQIYRGRLKDGSFVAIRCLKMKKSCSTQNLMHHIELIAKLRHRHLVSVLGHCFECYLDDSTVSRMFFVFEYV
PNGELRTWISDGHMGRLLTWEQRISVAIGVAKGIQFLHTGIVPGVYDNNLKMTDILLDNNLAAKLSSYNLPLLVEGLGKV
GQVGSRSGPKGTPSIKDEDKIDIYDFGVILLELIVGRPLRAKSQVDVLKEQLQASISADDGARRSMVDPTVHRACSDQSL
KTMMEICVRCLLKDPLERPSIEDVLWNLQFASQVQEGWLQNSNPSSNLGSPSPAASSLPPPSRLHVTTLESPRDSGCEEH
ER*

DNA
ATGGAGAAACTCTATTGTGGCATGCCGTTACTGCTTCTGGTTCTGCTTTTAGCTTCCATTGATGGCTCTACACAGCTACA
ATCATCTCAATCTCAAACCCTCTTGAGGCTGCAACAGCTTCTCTACTATCCCAAAGTGTTAAACAGCTGGAACAACTATA
CAGATTTCTGCAATTCTGAGCCAAGCCCTTCGCTAACCGTTGTGTGTTATGAAGATAGTGTAACGCAGCTTCACATTATA
GGAGACAATGGAACTCATATGTTACCAAAGAGTTTCTCAATAAACTCGTTTGTTACTACTCTTGTTAAGCTCCCTGATGT
TAAAGTTCTCACGTTTGTGTCCCTTGGGTTATGGGGTTGGTTACCTCAGAAAATCAACCGTTTATCCTCTTTGGAGATTC
TCAATGTGAGTTCCAATTTCCTCTTTGGACCAATCCCTCATGAACTCTCGTCGCTTGCTACTCTTCAGACGCTTATACTC
GACGAGAATATGTTTTCTGGTGAGTTACCGGATTGGATTGATTCTTTGCCGAGTTTAGCTGTGTTGAGCTTGAGAAAGAA
CGTGCTTAATGGGTCATTGCCTTCTTCTTTGAGTAGCTTGTCAGGTCTTAGAGTTCTTGCTTTAGCTAATAACCGGTTTA
ATGGAGCTTTGCCTGATTTAAGCCATTTGACAAACCTTCAAGTGCTTGATCTTGAAGGAAACTCTTTTGGACCGTTGTTT
CCTCGGTTAAGTAACAAGCTGGTTACTCTTATACTCAGCAAGAACAAGTTTAGATCTGCAGTTTCAGCTGAAGAAGTAAG
TTCTCTGTATCAGCTTCAACATTTGGATCTTTCCTACAATACATTCGTTGGTCCATTTCCTACTTCCTTGATGTCTCTTC
CCGCGATAACTTACTTGAACATTTCACACAACAAACTCACCGGGCGGCTTTCAGCAAATCTTTCTTGCAACTCACAGCTG
ATGTTTGTAGATATGTCATCAAATCTTCTTACCGGAAGTTTGCCTACTTGCCTTAAACCGAGTTCCGGCACTAGCAGAGA
TGTTGTCTATGCAAGCAACTGTTTGGCTACTACGAATGAAGATCAACGTCCAGTTTCTTTTTGTAGTAATGAAGCTCTTG
CTGTTGGAATCCTACCACAGAGGAGGAACAAAGTTTCCAAAGTGGGTATTGCTTTAGGTGTAACCGCAAGCATTCTCGGG
GTACTTCTCCTCGCCGGTGCCTTATTTGTGGTTCTTAGGAGATTAAATGCTAAGAAAACAGTGACGAAATCTTCCCCAAG
ATTGATTAGAGAGAATGCTTCAATGGGGTACACATCGAAACTACTATCAGATGCAAGGTATATCTCTCAAACAATGAAGC
TAGGAGGGCTCGGTCTTCCAGCTTACAGGACATTCTCACTGGAGGAGCTCGAGTATGCAACAAATAACTTTGAATCCTCT
GCTTTCATGGGTGAAGGTTCTCAAGGACAGATTTATAGAGGGAGATTGAAAGATGGATCCTTTGTGGCAATTAGGTGTCT
GAAAATGAAGAAAAGTTGCAGCACACAAAACTTGATGCATCACATTGAGCTCATCGCTAAACTGCGGCACCGTCACTTGG
TTAGTGTGCTCGGGCACTGCTTCGAGTGCTACTTGGATGATTCAACAGTCAGCAGAATGTTCTTTGTCTTTGAGTATGTC
CCAAATGGAGAACTCAGGACCTGGATTTCTGATGGGCACATGGGAAGATTGCTTACTTGGGAACAACGCATAAGCGTAGC
GATAGGTGTAGCAAAAGGGATCCAGTTCTTGCATACCGGTATTGTGCCTGGTGTTTATGATAACAACCTTAAAATGACAG
ACATTTTGCTTGACAATAACCTTGCGGCGAAACTCAGTAGCTATAATCTTCCATTGCTTGTGGAAGGTCTTGGAAAGGTG
GGGCAAGTAGGATCTCGGAGCGGACCTAAAGGCACTCCAAGCATCAAAGACGAAGATAAAATCGATATCTATGATTTTGG
AGTGATATTGCTTGAACTTATAGTGGGAAGACCATTGAGAGCAAAGAGTCAAGTCGATGTTCTAAAAGAGCAGTTACAAG
CAAGCATTTCAGCGGATGATGGAGCACGTAGGAGCATGGTGGATCCAACGGTCCATAGAGCTTGTTCAGACCAATCACTG
AAGACAATGATGGAGATATGTGTAAGGTGTCTCCTTAAAGACCCTTTAGAACGTCCTTCCATTGAAGATGTCCTGTGGAA
TCTTCAGTTTGCTTCTCAAGTTCAAGAAGGTTGGCTACAAAACAGCAATCCCTCGAGCAATCTCGGCTCGCCTTCTCCTG
CTGCTTCCTCTCTTCCTCCTCCCTCTCGTTTACACGTAACAACACTCGAATCTCCCCGAGATTCAGGATGTGAAGAACAT
GAGAGGTAG