Details for Arabidopsis Locus AT3G03720

Position : Chr3 ( 5`- 925612 .. 930974 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G03720

Protein [Map View]
MCLRIGKAVLWVDEETRDYLVVWNYDGFFAYHKKGDDKNNWKVIQPLMNQRCVDMVCKESKLYVLTDTHVTVLDFSHADA
SPIQCASFKSPNYGNDSFCGKNLAVTLSGQVLIVIHSGGVYKMDPKSLEWSRTNSLGDEAFIFDLGITVAAKDGVMKNCI
YFYADPPYRPRRRFVRNAESDGFALNRLENQTGVDSAKLVDMNSLVRRKQVDSVHLIKNDGPHQLAKKLSAVDLVAIGVG
TTIGAGVYILVGTVAREHTGPALAVSFFIAGVAAALSACCYAELASRCPSAGSAYHYAYICLGEGIAWLVGWALVLDYTI
GGSAIARGITPNLASFFGGLDNLPVFLARQTIPGVGIVVDPCAALLIMIVTILLCFGIKESSTVQAIVTSVNVCTLVFII
VVGGYLACKTGWVGYDLPSGYFPFGLNGILAGSAVVFFSYIGFDTVTSTAEEVKNPQRDLPLGIGIALLICCILYMLLSV
VIVGLVPYYSLNPDTPISSAFGDSGMQWAAYILTTGAITALCASLLGSLLAQPRIFMAMARDGLLPAFFSEISPRTQVPV
KSTIAIGVLAAALAFFMDVAQLSEMVSVGTLMAFTAVAVCVLVLRYVPPDGVPLSSSSQTLSDTDESRAETENFLVDAIE
SSDSPLLGNETARDEKYFGKRRKIAAWSIALVCIGVLGLASAASAERLPSFPRFTICGVSAVILLGSLITLGYIDEDEER
HNFGHKGGFLCPFVPYLPVLCILINTYLIINIGAGTWIRVLIWLLIGSMIYIFYGRSHSLLNNAVYVPTMTCTRKTTDHL
A*

DNA
ATGTGTCTTAGAATAGGCAAAGCTGTTTTGTGGGTAGATGAAGAAACCAGAGACTACTTAGTTGTTTGGAATTATGATGG
CTTTTTTGCATATCACAAGAAAGGAGATGACAAGAATAACTGGAAAGTGATTCAACCTTTAATGAATCAACGATGCGTGG
ATATGGTGTGTAAAGAAAGCAAGCTTTACGTGCTTACTGATACTCACGTCACTGTTCTTGATTTCTCCCACGCTGATGCT
TCTCCAATACAATGTGCAAGTTTCAAATCTCCGAATTATGGTAATGATTCGTTTTGCGGCAAGAATCTTGCTGTGACTTT
GTCAGGACAAGTTTTGATCGTTATACACAGTGGGGGTGTCTACAAGATGGATCCTAAATCATTAGAATGGAGCAGAACCA
ATTCTTTAGGAGACGAAGCATTTATTTTTGATCTAGGAATAACTGTTGCAGCCAAAGATGGAGTTATGAAAAATTGCATA
TATTTTTATGCTGACCCGCCTTATCGACCTAGGAGGAGGTTTGTACGCAATGCTGAAAGCGATGGGTTTGCTCTGAATCG
ATTGGAAAATCAAACCGGTGTGGACTCTGCAAAGTTGGTTGATATGAACAGTCTTGTGAGAAGAAAACAAGTTGATTCTG
TTCATCTTATCAAAAACGATGGACCTCATCAGCTTGCCAAGAAACTATCCGCCGTTGATCTTGTTGCTATTGGAGTTGGG
ACAACAATTGGAGCAGGAGTGTATATTCTTGTGGGAACGGTAGCTAGAGAGCACACAGGACCTGCTCTTGCTGTATCATT
CTTCATTGCTGGAGTAGCTGCTGCTCTCTCTGCCTGTTGTTATGCTGAGCTTGCTTCTCGTTGTCCATCTGCTGGGAGTG
CTTATCATTATGCGTACATTTGTCTTGGAGAAGGGATTGCTTGGTTGGTTGGTTGGGCACTGGTGTTGGATTATACAATT
GGTGGATCAGCCATTGCCCGTGGCATAACTCCAAATCTGGCATCTTTTTTTGGTGGTTTGGACAATCTTCCTGTGTTCTT
AGCTCGACAAACTATACCCGGGGTTGGTATTGTGGTTGATCCATGTGCTGCACTTTTGATTATGATTGTCACGATACTAC
TATGTTTTGGGATAAAGGAGAGTTCAACAGTACAAGCAATTGTAACATCAGTGAATGTTTGCACCTTGGTTTTCATCATA
GTAGTTGGTGGATATTTAGCTTGCAAGACTGGATGGGTTGGATATGATCTCCCCAGTGGGTACTTTCCTTTTGGACTAAA
TGGGATACTTGCCGGATCTGCTGTAGTATTCTTCTCATACATTGGATTTGATACTGTAACTAGTACGGCTGAGGAGGTGA
AAAATCCTCAAAGGGATCTTCCATTGGGAATCGGGATTGCATTACTGATATGCTGCATTTTGTATATGCTTTTATCAGTA
GTTATTGTTGGATTGGTCCCATACTATTCATTGAATCCTGATACTCCTATCTCCTCTGCATTTGGAGACAGTGGGATGCA
ATGGGCAGCGTACATCTTAACCACTGGGGCAATAACTGCTCTATGTGCGAGTTTGTTGGGTTCCCTTCTGGCTCAGCCAC
GAATATTCATGGCAATGGCTAGGGATGGATTGTTGCCAGCTTTCTTTTCAGAAATTAGCCCACGAACTCAAGTACCAGTG
AAAAGCACAATAGCTATTGGTGTTCTTGCCGCTGCACTCGCATTTTTCATGGATGTTGCACAGTTGTCCGAGATGGTTAG
TGTAGGCACTCTAATGGCATTCACTGCCGTTGCAGTCTGTGTGCTAGTTCTTAGATATGTACCACCAGATGGAGTTCCCC
TATCATCTTCCTCCCAAACTTTGAGTGATACCGATGAAAGTAGAGCTGAAACTGAAAATTTTCTTGTGGATGCTATAGAA
TCTTCTGATTCCCCTCTACTTGGAAATGAAACTGCTCGAGATGAAAAGTATTTTGGAAAGAGGAGAAAAATTGCTGCCTG
GAGTATAGCTCTTGTGTGCATAGGTGTCCTAGGTCTTGCTTCAGCAGCTTCAGCTGAGCGTCTTCCAAGTTTTCCTCGTT
TCACTATATGTGGTGTCAGTGCAGTCATCTTGCTTGGCAGTTTGATTACTCTTGGCTACATTGACGAGGATGAAGAAAGG
CACAACTTTGGACACAAAGGAGGGTTTCTCTGCCCATTCGTCCCATACCTTCCAGTTCTTTGCATTTTGATCAACACCTA
CTTGATCATCAACATTGGAGCTGGGACATGGATCAGGGTCTTGATATGGCTACTTATTGGAAGCATGATCTATATCTTCT
ATGGCCGATCTCACAGCTTACTGAACAATGCGGTTTACGTTCCCACAATGACTTGTACGAGAAAAACAACAGATCATCTT
GCTTAA