Details for Arabidopsis Locus AT3G03710

Position : Chr3 ( 5`- 919542 .. 925338 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G03710

Protein [Map View]
MLTSPSNALHSSTPQFWPLRRSKLCRSRNFPRFHSGERSSGGGGKLCSLSLLSGSGAGKFSVRALVRPDDTDDADSVGDG
SLAFPNHVSVKIPFGNREILVETGLMGRQASSAVTVTDGETIVYTSVCLADVPSEPSDFLPLYVHYQERFSAVGRTSGGF
FKREGRTKDHEVLICRLIDRPLRPTMPKGFYNETQILSWVLSYDGLHAPDALAVTSAGIAVALSEVPNAKAIAGVRVGLI
GGEFIVNPTVKEMEESQLDLFLAGTDTAILTIEGYSNFLPEEMLLQAVKVGQDAVQATCIAIEVLAKKYGKPKMLDAIRL
PPPELYKHVKELAGEELTKALQIKSKISRRKAISSLEEKVLTILTEKGYVIDEVAFGTIEAQPDLLEDEDEDEEVVPEGE
VDQGDVHIRPIPRKPIPLLFSEVDVKLVFKEVSSKLLRRRIVEGGKRSDGRTLDEIRPINSRCGLLPRAHGSTLFTRGET
QALAVVTLGDKQMAQRIDNLEGSDEYKRFYLQYTFPPSSVGEVGRIGAPSRREIGHGTLAERALETILPSDDDFPYTIRV
ESTVIESNGSSSMASVCGGCLALQDAGVPVKCSVAGIAMGMVWDTEEFGGDGSPLILSDITGAEDASGDMDFKVAGNEDG
VTAFQMDIKVGGITLEIMEKALIQAKAGRRHILAEMAKCSPPPTLSLSKYAPLILIMKVHPSKVYSLIGSGGKKVKSIIE
ESGVEAIDMQDDGTVKIMAIDVASLERAKAIISGLTMVPSVGDIYRNCEIKSMAPYGAFVEIAPGREGLCHISELSAEWL
AKPEDAYKVGDRIDVKLIEVNEKGQLRLSVRALLPESETDKDSQKQQPAGDSTKDKSSQRKYVNTSSKDRAAAGASKVSS
GDELVLKKKDVRRATGGSSDKTMNSNSSTNEESLVNGEATIS*

DNA
ATGTTGACGAGTCCCAGTAACGCACTTCACAGTAGTACTCCACAATTCTGGCCACTTCGCCGGAGCAAGCTTTGCCGTTC
CCGGAATTTCCCTCGTTTTCACTCCGGCGAACGCAGCAGCGGCGGAGGAGGAAAATTGTGCTCGCTCTCTCTTCTCTCCG
GAAGTGGCGCCGGTAAATTCAGTGTCAGAGCTCTAGTTAGGCCTGATGATACCGACGACGCTGACTCCGTCGGCGATGGG
TCTCTGGCTTTTCCTAACCACGTTTCTGTCAAAATTCCATTCGGAAATAGAGAGATTTTAGTTGAGACTGGTCTCATGGG
GAGACAAGCAAGTTCTGCAGTCACGGTCACAGATGGAGAAACTATTGTCTACACATCCGTTTGTCTAGCTGATGTTCCGA
GTGAGCCATCAGATTTTCTTCCCCTTTATGTTCACTATCAGGAGCGATTCTCAGCTGTAGGTCGAACTAGTGGTGGATTT
TTTAAGCGAGAAGGGAGAACCAAAGATCACGAGGTTCTGATTTGTAGGTTGATCGATAGACCTCTACGCCCCACTATGCC
CAAAGGTTTCTACAATGAAACTCAGATTTTATCCTGGGTTTTGAGCTACGATGGATTACACGCACCTGATGCTTTAGCTG
TTACATCTGCTGGAATTGCTGTAGCTCTTTCAGAAGTACCAAATGCGAAAGCGATTGCAGGAGTTCGGGTTGGTCTTATT
GGGGGTGAATTCATTGTCAATCCAACCGTGAAGGAGATGGAAGAATCACAGCTAGATTTGTTTCTAGCTGGAACAGATAC
TGCAATTCTAACGATAGAGGGATACAGTAATTTTCTTCCTGAGGAAATGCTTCTCCAAGCTGTTAAAGTTGGACAGGATG
CTGTACAGGCTACATGCATTGCTATTGAAGTTTTAGCAAAGAAATATGGAAAGCCTAAAATGCTTGACGCTATCAGATTA
CCACCTCCAGAGCTATACAAGCATGTGAAAGAACTTGCTGGTGAGGAATTGACAAAAGCGTTACAAATTAAGAGTAAAAT
ATCGAGAAGGAAAGCCATATCGTCCCTGGAAGAAAAGGTCTTGACAATACTGACAGAGAAGGGATATGTTATTGATGAGG
TAGCTTTTGGAACCATAGAAGCACAACCGGATCTGTTGGAGGATGAAGACGAGGATGAGGAAGTTGTTCCTGAAGGTGAG
GTGGACCAAGGCGATGTTCACATTAGACCCATCCCTCGGAAACCTATTCCTTTACTATTTTCTGAAGTAGATGTCAAGCT
AGTCTTCAAAGAAGTATCGTCGAAGCTTCTACGTAGGCGAATTGTTGAGGGAGGTAAAAGAAGTGATGGTCGGACTCTGG
ATGAGATTCGTCCAATTAATTCAAGATGTGGACTGCTTCCCAGGGCACATGGAAGTACTCTGTTCACACGTGGGGAAACA
CAGGCACTGGCAGTTGTTACGCTTGGTGATAAACAAATGGCGCAGAGAATTGACAACCTTGAGGGTTCTGATGAATACAA
GAGGTTCTATCTTCAGTACACTTTTCCTCCATCGTCTGTTGGTGAAGTTGGACGAATTGGTGCACCCAGTAGAAGAGAAA
TAGGTCATGGGACACTAGCAGAGCGAGCATTGGAGACCATTCTACCTAGTGATGATGACTTTCCTTACACAATACGTGTT
GAAAGTACAGTAATTGAAAGCAATGGTTCTTCAAGTATGGCATCTGTTTGTGGCGGTTGCTTGGCTTTGCAAGATGCTGG
AGTTCCAGTCAAATGTTCTGTTGCTGGGATAGCAATGGGAATGGTTTGGGATACTGAAGAATTTGGAGGTGATGGATCTC
CCCTTATCCTTTCTGACATCACTGGAGCTGAAGATGCATCTGGTGATATGGACTTTAAGGTTGCTGGGAATGAAGATGGC
GTTACCGCCTTTCAGATGGACATCAAGGTAGGAGGAATTACTTTAGAGATAATGGAAAAGGCTCTAATACAGGCAAAAGC
TGGGCGTCGCCATATTCTTGCTGAAATGGCAAAGTGCTCACCGCCTCCCACGCTAAGCCTCTCAAAATATGCTCCATTGA
TACTTATTATGAAGGTTCATCCAAGCAAAGTATACTCTCTTATTGGTTCTGGAGGTAAGAAAGTAAAGAGCATCATTGAA
GAATCTGGAGTTGAGGCCATTGACATGCAAGATGATGGAACTGTCAAAATTATGGCAATTGATGTAGCGAGTCTAGAAAG
GGCGAAAGCGATTATTAGTGGATTGACAATGGTTCCCTCTGTTGGTGATATCTACAGGAATTGTGAAATCAAGTCAATGG
CTCCTTATGGTGCATTTGTAGAGATAGCGCCTGGGCGGGAAGGTCTTTGCCATATCAGTGAGCTGAGTGCTGAATGGCTT
GCAAAACCAGAGGATGCCTATAAAGTAGGAGACCGCATTGACGTCAAATTAATAGAGGTAAATGAAAAGGGTCAGCTTCG
ACTTAGTGTACGGGCTTTACTTCCCGAATCAGAGACAGACAAAGACAGTCAGAAACAACAGCCGGCAGGTGATTCTACCA
AAGACAAGAGTTCGCAAAGGAAATATGTAAATACTTCGTCAAAGGACCGTGCAGCTGCAGGAGCATCAAAGGTTTCATCT
GGGGATGAACTTGTCCTGAAGAAGAAAGATGTAAGGAGAGCAACTGGTGGTAGTAGTGACAAGACAATGAATAGCAATAG
CAGTACCAACGAAGAAAGTTTAGTCAACGGTGAAGCTACAATCAGCTAG