Details for Arabidopsis Locus AT3G03700

Position : Chr3 ( 5`- 916435 .. 918490 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G03700

Protein [Map View]
MPTPTSNGHASRVQIQEPRIMSPLPPSSSPIAFKEQQGRPPPTTQQTIAGKLFRTLFKGLLFSQLTLISLLVIVLTIRGL
ISASTHHFHLKKWYPPLLASVAVSGIASLAWQCIFIYNPSRAVKATFWLSPILTCSVGILLVLIGSAVDAGIGAVFVLFA
ITQSLYGCWITPRLEYTDKILSLATAFPPARTREVVCLSIIVSVVYSGFLVTGIGGATSTRTNLDILFISVIIISLAWTM
QVIKNVQQVAISRARYVNFAHGEDMDAWNAFRITMKHLTGSICVGSTLVPIIVFIRGSIRSVNLMSGSSDEVMYSGADCF
STIANKLITLGNRWGFVHVGTYDKGFMEASSDTWKKFRSTTGLEKLIDSDLTSSFCFLSAVSVGAVSSLTAGIWMLLIHK
DYALEVTLYAFIIGYFVGRVGLAWLQACVLAYYVAYSEDPQSMRFDGTIPQRIQRLQMLSAHRDNRELEVGRDREEDSYN
NC*

DNA
ATGCCTACACCAACAAGCAACGGTCATGCCTCTCGCGTGCAGATTCAAGAACCAAGAATAATGTCTCCTCTTCCTCCTTC
TTCTTCTCCAATCGCCTTCAAGGAACAACAAGGTAGACCACCTCCAACAACACAACAAACCATAGCAGGAAAACTCTTTA
GAACTCTTTTCAAGGGTCTTCTCTTCTCACAACTAACCTTAATCTCACTTTTGGTGATCGTTCTCACCATTCGCGGTCTC
ATCTCAGCAAGTACACACCATTTCCACCTCAAGAAATGGTACCCTCCTTTACTAGCATCTGTTGCTGTCTCAGGAATTGC
ATCTTTAGCATGGCAATGCATCTTTATCTACAATCCATCAAGAGCAGTCAAAGCAACGTTCTGGCTTAGTCCAATACTCA
CCTGCTCGGTAGGAATCTTGCTTGTTTTGATTGGCTCAGCGGTAGATGCAGGTATAGGTGCAGTGTTTGTCCTTTTCGCC
ATTACTCAGTCCCTCTATGGTTGCTGGATTACTCCGAGGCTTGAGTACACCGATAAAATATTATCACTTGCCACAGCATT
TCCACCTGCAAGAACCAGAGAAGTAGTCTGCTTATCAATCATAGTCAGTGTCGTTTACTCTGGTTTCTTGGTGACTGGAA
TTGGAGGAGCAACTTCCACTAGAACAAATCTTGATATCTTGTTCATATCCGTAATCATAATAAGCTTAGCATGGACGATG
CAAGTTATCAAGAATGTTCAACAAGTTGCGATTTCACGGGCGAGATATGTAAACTTTGCACATGGAGAAGATATGGACGC
TTGGAATGCTTTCCGCATCACTATGAAACACTTGACTGGGAGCATCTGCGTTGGCTCGACGCTTGTTCCAATCATCGTAT
TCATAAGAGGATCAATAAGAAGTGTTAATCTAATGTCAGGGAGCAGCGATGAGGTCATGTATTCAGGTGCTGATTGCTTC
TCTACCATTGCTAACAAACTCATTACACTTGGAAACAGATGGGGCTTTGTACATGTTGGAACCTATGATAAAGGATTCAT
GGAGGCTTCGAGTGATACCTGGAAGAAGTTCAGAAGCACAACAGGGTTGGAGAAACTGATTGACTCGGATCTCACTAGCT
CCTTCTGTTTTCTCAGTGCTGTTTCTGTTGGAGCTGTCTCTTCATTAACTGCTGGGATATGGATGTTGTTAATACACAAG
GACTATGCCCTGGAAGTGACTCTCTATGCTTTCATAATTGGATATTTTGTGGGAAGGGTAGGTTTGGCGTGGCTACAGGC
ATGTGTATTGGCTTACTATGTAGCTTATTCTGAAGATCCTCAGAGCATGAGATTTGATGGAACAATTCCACAACGTATTC
AGCGTCTTCAAATGTTAAGTGCTCACCGAGATAACAGGGAGCTTGAGGTGGGTAGAGACAGAGAAGAAGATAGTTATAAC
AATTGTTGA